ࡱ>                 H F D d #`0(8bjbj\.\.>D>D_paaaaTbTbTbhbnnn8,o,Xohbo(oooo x&Fx RxSUUUUUU$hjy]TbMyv|hwMyMyyaaoo.|||MyaoaRoSF|MyS||j;a2b"y oto ^nz@0#Vn{nd nTb{TZx0x"|xxZxZxZxyy}|vZxZxZxMyMyMyMyhbhb$bjhbhbbjhbhbhbaaaaaa A Win The Web 2008 programozi verseny klndjas csapata tvette a djat az Interware-tQl A 24 rs programozi verseny  Northwind nevq csapata nneplyes keretek kztt tvehette az Interware ZRt. ltal felajnlott klndjat, mint a verseny leginnovatvabb dikcsapata. A kzelmltban megrendezett versenyen a profi fejlesztQk mellett szmos dik is ringbe szllt, hogy megmutassa a  nagyoknak tudst, s tehetsgt. Az Interware, mint a verseny technikai htterl szolgl, s a tbb, mint 4.000 szervernek otthont ad, Szerver Hotel zemeltetQje, nagy hangslyt fektet szolgltatsainak folyamatos fejlesztsre, s a minQsg sznvonalnak magas szinten tartsra, ezrt a versenyzQk kztt is azokat a fiatal tehetsgeket kereste, akik jszerq ltsmddal, s innovatv megoldsokkal oldottk meg a kiadott feladatot. gy esett a vlasztsa a  Northwind nevet viselQ dikcsapatra, amely a Budapesti Mqszaki s Gazdasgtudomnyi Egyetem Villamosmrnki Karnak Villamosmrnki, illetve Mqszaki Informatika szaknak IV. ves hallgatibl llt ssze. A csapatot Kovcs Tams, rvai Zoltn, Formanek Gbor alkottk, kiegszlve egy grafikus segtsgvel, a szintn dik Fogarasy Tams szemlyben. Az Interware vezetse a Szerver Hotel bemutatsval egybektve adta t a klndjat. A csapat 1 vig hasznlhat egy a Szerver Hotelben elhelyezett szervert, amely a jvQben segtsget nyjthat tanulmnyaikhoz, akr sajt vllalkozs beindtshoz is. Az ifj versenyzQk a jvQben fQknt ipari alkalmazsfejlesztssel szeretnnek foglalkozni, .NET alapon, s Microsoft technolgikkal.  Nagyon szimpatikus volt, hogy rgtn j genercis .NET technolgikon lehetett fejleszteni (ASP.NET 3.5), tovbb az is motivlt minket, hogy sok hasonl rdeklQdsq fiatalt ismerhettnk meg, nagyszerq hangulatban. Ezzel a csapattal elQszr indultunk ilyen jellegq versenyen s nagyon rlnk, hogy mi nyerhettk meg az Interware "Leginnovatvabb csapat" djt, jvQre is indulni fogunk!  mondta rvai Zoltn, a klndjas  Northwind csapat tagja.  rmmel vettnk rszt a Microsoft Magyarorszggal a verseny lebonyoltsban. Vllalatunk rgta elktelezte magt az informatikai oktatsban tanul fiatal nemzedk segtse mellett. Ezton is szeretnk gratullni a  Northwind csapat tagjainak, s persze minden rsztvevQnek, akik a verseny 24 rja alatt bizonytottk tehetsgket, tudsukat, s nem utols sorban kitartsukat, ami mltv tette Qket az Interware s a szakma elismersre. Bzunk benne, hogy a klndjas csapat s az Interware kztt kialakult j kapcsolat a jvQben akr szorosabb is vlhat szakmai tren, s a felajnlott szolgltats csomagnak j hasznt veszik majd. - mondta Stor Csaba, az Interware vezrigazgat-helyettese. Az Interware ZRt-rQl J " $ $$5&5*5,5.5T5Խ~uk^P? hbhAeUCJOJQJ^JaJhZCJOJQJ^JaJh,h,OJQJ^Jh,OJQJ^JhWmRh,^JhWmRh2Ol^JUhHhZhkZ hkZh+ch: hv$hv$^Jhv$h(aJhv$ hv$hv$-hv$h:9;CJaJmHnHsH tHu-hv$hv$9;CJaJmHnHsH tHu'hv$9;CJaJmHnHsH tHu$ N P HJnpfhvx*'d(f(+(.*.11gd2OlgdkZgdv$ &dPgdv$^gdv$ 77&8A tbb mint 10 ve piacon lvQ, 100 %-os magyar tulajdonban lvQ Interware a legjelentQsebb magyarorszgi Internet szolgltatk kz tartozik. Organikus fejlQdsvel, folyamatos innovcival egyrtelmq piacvezetQ pozcit vvott ki magnak a szerverelhelyezs, valamint a domain szolgltatsok tern. Az 1.000 ngyzetmteren zemelQ Szerver Hotelben elhelyezett szerverek szma meghaladja a 4000-et, mellyel a magyarorszgi internetes tartalom kzel 60%-t szolglja ki. A vllalat meghatroz szerepet tlt be az internet hozzfrs szolgltatsok piacn is. Egyarnt knl ADSL, valamint tbb technolgiai platformon brelt vonali szolgltatsokat. A biztos alapot nyjt, a legmagasabb mqszaki sznvonalat kpviselQ infrastruktrval megvalstott egyedi internetes megoldsok mellett a cgcsoport tevkenysgi krbe tartozik immr az Online Mdia is. Az Interware nevhez kapcsoldik az egyik legnagyobb - az altavizsla.hu, a freeweb.hu s a tar.hu alkotta  hazai Online Mdia portfoli is. gyfelei kztt a kis- s kzepes vllalkozsok mellett megtallhatak a legjelentQsebb magyarorszgi internet szolgltatk, nemzetkzi tvkzlsi vllalatok, kltsgvetsi szervek. A folyamatos, vrQl-vre ktszmjegyq nvekedshez hozzjrulnak az egyni elQfizetQknek nyjtott szolgltatsok is. A cg 2006-ban felkerlt a Europe's 500 - Entrepreneurs for Growth szervezet ltal kzztett, a leggyorsabban nvekvQ eurpai cgeket felsorakoztat elQkelQ 500-as listjra, 2007-ben pedig a magyar internetszolgltat cgek kzl egyedliknt vehette t a vilg egyik legjelesebb tancsad cge, a Deloitte ltal alaptott  Technology Fast 50" djat, amely az 50 legdinamikusabban fejlQdQ kzp-kelet eurpai technolgiai cg kz sorolja az Interware ZRt-t. 2007 vgn megvsrolta az egyik elsQ hazai alternatv tvkzls vllalatot, az eTel Magyarorszg Kft-t, mellyel immr teljes rtkq telekommunikcis szolgltatv vlt. 2008-ban az Interware mrkt Business Superbrand elismerssel djazta a neves szakemberekbQl ll Business Superbrand Bizottsg, ezzel is megerQstve azt, hogy az Interware a piaci szereplQk kzl a minQsggel, megbzhatsggal s kivlsgval is kiemelkedik. Tovbbi informci: Hegyi Ferenc  marketing manager Interware Internet Szolgltat ZRt. E-mail:  HYPERLINK "mailto:info@interware.co.hu" info [kukac] interware.co.hu  HYPERLINK "http://www.interware.hu" www.interware.hu          Sajtkzlemny  2008.07.07. Azonnali kzlsre! Sajtkzlemny  PAGE 1. 133&5(5*5,5T555666 7777777 7"7,7 p#<t"$H]H^gdG.#gdAeUxgdAeUgdpgdWmR$a$gd2OlgdIT555555B6D6^6|6~6666666ʵzdO::(hbhAeU0J5CJOJQJ^JmHsH)jhbhAeU0J5CJOJQJU^J*jhLoOJQJU^JmHnHtHu(hhAeU0J>*B* OJQJ^Jph3f(hh0J>*B* OJQJ^Jph3f hhAeU0J5CJOJQJ^J)jhhAeU0J5CJOJQJU^JhZ0J5CJOJQJ^J hbhAeU0J5CJOJQJ^JhbhAeUOJQJ^JhOJQJ^J6666666677777 7 7777777"7ֱֿsfYLD@D@D@D@h~_jh~_UhZh!OJQJ^JjҤha(h~_<UjNha(h~_<UjXha(h~_<Ujha(h~_<Uh!0J5CJOJQJ^J*jhLoOJQJU^JmHnHtHuh:0J5CJOJQJ^J-hbhAeU0JB* OJQJ^JmHph3fsH)jhbhAeU0J5CJOJQJU^J'jhbhAeUOJQJU^J"7$7(7.70727476787T7V7X7b7d7f7h7j7n7p7777777778 8λ~~uieWhl%hP656CJ(aJ(h~_h{h*759aJhZ59aJhv$59aJh!59aJhZ59aJhl%59aJh*759aJhF59aJ h#]h*7$jh#]h*7UmHnHtHujh*7UmHnHtHuh*7jh*7UmHnHujhP6UmHnHtHu,7.74787777778 8"8$8&8(8gdpgd#]$a$gdP6 $ a$gdv$$a$gd#] 8 88888 8"8$8&8(8õhZh!OJQJ^Jh&h*7h#]h*756B*phh*756B*ph hWmR56B*mHnHphuhPh*756B*ph$jhPh*756B*Uph :&P 1h/R :p!. A!|"#$% FH$cnrV_JFIFHHuExifMM*bj(1r2iHHAdobe Photoshop 7.0 CE2008:05:27 16:36:24"(*CHHJFIFHH Adobe_CMAdobed            7"?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?^'#Xhm`sS7~k}Gzz:MdW,m6_ܧ3cԱmcogvߪ˻#_՞m1f:a'N;{qwO*W+'I0,`q"U_g:d2.~l lanmmoˬ̱[g-Wo*ؑ$Ba$^q0pdOT}'4!M`}b_amxX:]wȫQӱs) gMmۛ;`DkEUߥ~vB7e.9ٝS a> olwvvьr7V5XY_]:.Ve5mۿ++?XS  ݻ&sf:ӍO}Բ?Hwnܺs}o6[9dYB5,|f^я~qԷU:unv>C62c+z}<6ۻk^eV˗J.]Ϡ\,-vF]թ߿f?JG u>q[20Yes=,lEs_f+=̌i"KtWeXdžmn~{>0x!Dz/Ge?77\7l[ʛb\7އھӓs۹\vEtvV.m # 8eo7ks:2;c0$ (χ_UMm.8ehv1ߥ?ةϱ^T@mc^CX7k>}O["AcK83[^75{/W#L}%eiG:}й8Ɵ?.IX$R@oun)ȦF>h{]v,~l/EyPI1?n[#;PJ5/=Gi]Km. 9?Q`Dӕ[?Ǣϩ_7f- ri&@5wmNV:_O'u]~4 }UTG&xx~\Hr;Y4S׺֬<90p]SywOGZ݄j_c0'%1ڔx,hgWkaǿ^гw$/jQgR[o͡ظclِ/+}k+0/%ݗ8ĵ5`z}YiتRcOׯq nwׇ .#G?VϪS㵭.'j unA˗0/Z{e, ~YkGGWY5KE^ùwZ?ޔ4+Ϫ9k|Sd/C;0,/96o}wGՇ~n(.,l}w$"d>a2@KiU?~?%ʸOVK~\޷հs~NUnX}e/ѹgZ*XYz Pr}w}[\ݮZǼ<]JiOs6,/Q/DpMn~ᆬE2Mn]G315p0,kv/>Ze?,~>:fSqRmhR[v:?"nVO6?nX/W;,Ӷ,o->N:r'"?~Wzuy.c/cC}K^\{eX;O''c^,WZ6z'bF&D3cL9i2\α'aQ;>%{}~y+[ìU]} 8߶5Gz?oY٣'=JW!d^.W_<&\~Ԡ%gڎ=Q複z.̏*P;>:?]UT쾧f6szc2;v3uz[ԯ_WߚF-,P;w?ͼ2+if.(ˋ)Rc/~\~[Ye}zs|4/]o ( ۜoz#ꓝ,8u5za;׿m^lM~LM]oo e_I|q~ KX?Z/X՜O.coI}ı>rkQlWzB.ܫn99F["UUVvUV#>f͎^錯G#.^k0E-i2VYc*tSQÝZk5~y>ɱoVgWi&׸|~ᯖU'}zķ;[(rmͯk۹ů6vIW U8pWۋ_:`tf׶;{tCd3{]UI_1;?U$UI$?U$UI%?U$UI%?U$UI%?U$UI%?0Photoshop 3.08BIM%8BIMHH8BIM&?8BIM x8BIM8BIM 8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM8BIM8BIM@@8BIM8BIMG Nvtelen1nullboundsObjcRct1Top longLeftlongBtomlongRghtlongslicesVlLsObjcslicesliceIDlonggroupIDlongoriginenum ESliceOrigin autoGeneratedTypeenum ESliceTypeImg boundsObjcRct1Top longLeftlongBtomlongRghtlongurlTEXTnullTEXTMsgeTEXTaltTagTEXTcellTextIsHTMLboolcellTextTEXT horzAlignenumESliceHorzAligndefault vertAlignenumESliceVertAligndefault bgColorTypeenumESliceBGColorTypeNone topOutsetlong leftOutsetlong bottomOutsetlong rightOutsetlong8BIM8BIM8BIM _7RCJFIFHH Adobe_CMAdobed            7"?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?^'#Xhm`sS7~k}Gzz:MdW,m6_ܧ3cԱmcogvߪ˻#_՞m1f:a'N;{qwO*W+'I0,`q"U_g:d2.~l lanmmoˬ̱[g-Wo*ؑ$Ba$^q0pdOT}'4!M`}b_amxX:]wȫQӱs) gMmۛ;`DkEUߥ~vB7e.9ٝS a> olwvvьr7V5XY_]:.Ve5mۿ++?XS  ݻ&sf:ӍO}Բ?Hwnܺs}o6[9dYB5,|f^я~qԷU:unv>C62c+z}<6ۻk^eV˗J.]Ϡ\,-vF]թ߿f?JG u>q[20Yes=,lEs_f+=̌i"KtWeXdžmn~{>0x!Dz/Ge?77\7l[ʛb\7އھӓs۹\vEtvV.m # 8eo7ks:2;c0$ (χ_UMm.8ehv1ߥ?ةϱ^T@mc^CX7k>}O["AcK83[^75{/W#L}%eiG:}й8Ɵ?.IX$R@oun)ȦF>h{]v,~l/EyPI1?n[#;PJ5/=Gi]Km. 9?Q`Dӕ[?Ǣϩ_7f- ri&@5wmNV:_O'u]~4 }UTG&xx~\Hr;Y4S׺֬<90p]SywOGZ݄j_c0'%1ڔx,hgWkaǿ^гw$/jQgR[o͡ظclِ/+}k+0/%ݗ8ĵ5`z}YiتRcOׯq nwׇ .#G?VϪS㵭.'j unA˗0/Z{e, ~YkGGWY5KE^ùwZ?ޔ4+Ϫ9k|Sd/C;0,/96o}wGՇ~n(.,l}w$"d>a2@KiU?~?%ʸOVK~\޷հs~NUnX}e/ѹgZ*XYz Pr}w}[\ݮZǼ<]JiOs6,/Q/DpMn~ᆬE2Mn]G315p0,kv/>Ze?,~>:fSqRmhR[v:?"nVO6?nX/W;,Ӷ,o->N:r'"?~Wzuy.c/cC}K^\{eX;O''c^,WZ6z'bF&D3cL9i2\α'aQ;>%{}~y+[ìU]} 8߶5Gz?oY٣'=JW!d^.W_<&\~Ԡ%gڎ=Q複z.̏*P;>:?]UT쾧f6szc2;v3uz[ԯ_WߚF-,P;w?ͼ2+if.(ˋ)Rc/~\~[Ye}zs|4/]o ( ۜoz#ꓝ,8u5za;׿m^lM~LM]oo e_I|q~ KX?Z/X՜O.coI}ı>rkQlWzB.ܫn99F["UUVvUV#>f͎^錯G#.^k0E-i2VYc*tSQÝZk5~y>ɱoVgWi&׸|~ᯖU'}zķ;[(rmͯk۹ů6vIW U8pWۋ_:`tf׶;{tCd3{]UI_1;?U$UI$?U$UI%?U$UI%?U$UI%?U$UI%?8BIM![Adobe PhotoshopAdobe Photoshop 7.0 CE8BIMHhttp://ns.adobe.com/xap/1.0/ adobe:docid:photoshop:129d03e8-2bfa-11dd-baf0-899601dfb8d6 Adobed@2     u!"1A2# QBa$3Rqb%C&4r 5'S6DTsEF7Gc(UVWdte)8fu*9:HIJXYZghijvwxyzm!1"AQ2aqB#Rb3 $Cr4%ScD&5T6Ed' sFtUeuV7)(GWf8vgwHXhx9IYiy*:JZjz ?ߺ^׽t=֝aCSb6_ 6G|ҡo5iBQl覌WR_.WBR+@iZ}8RSYESOYISOUK4uԒcrͧ5s]|᱐)K_7P\?O~y#KWԐK+e{*5gbA8:ܻwvcbmlry#-9lDtʑW㧩n$Tn}A^o%x¼*:Oe{Gyov&s2o0E7C(Ђ.9F @Ζ[[ݯZrg0h{•Q3yOS?YSIGGmW1UW^CKM91[=Ml"ĊfA${WO&MC89w ^ I/Ib[N5z7^׽u~{ߺ^׽tɸ7.xs;?Xx8n  ZԱ‚WtKWԚқK+u{ *q玸mӶ713[KqwNILxǞxQUJBPG$"/5ZnnrrtHC` :~~t/_g3[_ ncsPyn>!sjRWMgh]$\y On]mW1=4: 9PT9e΋zFv/_c->oCk:MY𔻖JF));!ab%+mWTH|+8eͻd;U 2D]"u8eq}oHؽ}+(q}ݩ_C&6r|& !B^)]K5Z %VyህeV<*@f(nڮn"O.+UH|W,sF"KG$nIWGR ؃<:. *Œ}"كOC+f_Yhx]G͟?M7Й763sx|"WR䱵JurKU _o+0*x~Έ--' JBȎۦzu{{^׺ߺ^?C{:+Ϧ_G^̏/\Pd1{q)*jUJYdCE=4e?t[PJZ5<dݷwniɛqC>U%l8 * Lu"iUңn+;'~|~ߛ08ٙ[QV9*M)_ɈHkih9&l[snHFI5$Ҕz}Ʋr˴YZnw4Vш(Ui1Z2;O4 zu{lEi=KXCA"$>&GGtU1oW[7xgXΓ4݇0b6&[~)1ۛMhj[6- j`@p(A }Gۯl=޷WSo+m9CRѱGmdtdkgW{8س|>C=bϱ}ͯ]__uZ11Eu.gv i3=ܭ㆓qל"ob)h&*8y3՟ϫS?|˿[=P?W| }?jPSIޙG_˫got\j+1ݫm^Z n*թ$tԍNXKS.m_fB"(b0hWО?!N>/'ޏ=|m$ek6h#>5M$ܯ[W/{o tnoq=vj vU[jYqaLᬄJ-ya=qQwSI҄f3ԏwnpo=NW1'tf)-b-Zdr6 ?Os͹_=cj1Cuo_s?dh91W'\ݒOq?:3Wʜ_ϔQ;~66tbXCOYc]uc 9;r]Jq_&VgIRoW!Λ|5v"] L0I? O% ?/?'kI8F6[Q}7TV3n!DY E,l]&= Qzr_~*+WdAzrwdyJ:\dShq1,*2mvXn ըi?c\|,|- l"IGxS* uëq`Ffط6lO먞c^4Y}T9O{:\u~{ߺ^׽u~k+w/;ozzB_S%N7g7DVrqy2dy O"ۖ.}k/;P b 8+^2=ߴ>ԗo<ߩi֓+ۻ/NjmTrB'xZo0[m{1`$U +A 5Iʟq=|.#-ٞ[i$k UaHrQwZtVn|#=Ѹp5g`a諨!mۛx E5m/&W9nRYiyɩ! "*H+*yǜwhlRf#n\#jcF Gl*?We:MmQnm\C_}]Qv[zpmEEFISU4u4\l ٧۶yvAԄYʾl{/Xʚe.2%rB$TEr8o^߱# #5RG#v1 ڻG!$MOOQUN4# WqGLpzH,lNΓTI|#;߬zʔɎVvyqjPa.%/rZ^d"5Ʀa"{| iuk"E#ܬ7)u#$j)Z*GM6?";Ӳ67v3)ۋz bgh{]͎T|{#TS0G ;`Svƍj jK&^Ec:v}oc/N[w+C"G on`JQwY,^2$oxQ ۸ۣ:]Ùm>_'z4w4!*)*igT} )$- aJ5N' ||G{,\|pD#= 2$"gSN՛k%>c A#q9Jct5ԕQT2IWGTww#Y(zr=sw!\n9,k(wPP8^?+i-_ػ{>4_b}ͯ]^K[_~O_im=wvN+tI{w(3Pغx0&qFɵ_;+Q054ϯ]R>FCpNZǸy3H3ކj!՗yAS{_ 6;~GwWb>קYksYAWUٕc#$+K) 3NyrkHXjA94z'7u>`I h.(&Hb$i:?? ÇMCccA˿~W}C_pZGGߛA,=(I3[{6tQ/$jrw9!fX(SZnai80!qV8cP4am$[|ғ$2S%QԢm 3B5[jmr7Jǎx֊TTҴ=JԀcRkdJsÐ~{jR5 Z7+B F+)jق#/}m_w_enݻ\bp[hgV`RXMN>7(2g"kM9bȪz~[}W辵[hZWΌkқ|,t?gyCWmM%\x eW} eo,*yֳna[_YozM);o%i$ >X6T<3jq?N#u]s{6ݶ#<*iKao6 0bOo=Źi)7l?ʎRcM}+{+ODK-5Y0y >\y $c,OQ#d寻˖,emvіA{c!E~}+ATy G}RzV[瞛4}2E?H5.@no wU4bN>-z[@u( դtw?zwv-#qomˌh7>/'0?}{KROrGKQʌl\żo:WRƘ8^7^vٯuhNҞo. *ڔZUA udͻZmxӬ$5q07N*_=ud70 2Vi15^bv$! A|#~=Mir]1^'HTꦒ!ĨQ_߹~%|^}2ulW㶮ɘ.lN. ^DzMd_d"?x*<$]i{OۯX/q/|AE VW|:Jx/=MOhh`/,mogǏ<:R$^"] ?羸9޺^׽u~{ߺ^?O~}[N'xnHbv?YўMLH#2{'<440zʘ++yjDI7xM:r,̛?+lp7[$Bfc䑨gsǀP1d=0l ɽ(wL}_kJ}32C%^36t5m $ KYU֥\m6\oW#7~]d27{3j-#Զn'n 5ԪPT1j vL!uicPLC/ܛJ6ȥ"Gcb {?Q`>V$M=÷P>o-YWKE(JҨ85kit~%MlX>\ !+(c+Si{ouf/m_/nI۸Uoeuwm>F{yS6䭺D뺾Өߊl?H҉uʉ \9Iw$.@FZb[];?Ob%{Ð%)x I_M:ufu{{^׺ߺ^s~v|,qO]ovnꀬlhw2n۔^;Ǎ?:vC_֥tlV:kmf,OLPTR|SME=Q ֨SVky9G\ʒ{=JlcuzJz-2+2G){M%+K$RIs75Uh5U^ @$݈i8x_Hzo>;ݙq^ u Eր `wvwO=ypzNM1#!6e.?DqM]C fQ$^ *ZV$PMn=vH6mIdl*"H OM)>h{qY^mF{166s9zeFqGɚdjt[^gI[nxޘm N 5*tUF^5ZKwƨ9[lυPm ' 6.)WÉc|s5ytBR5h2mɾ/uiUkT/vr꼏N%-$mTf]*Wd'.H6> wgt'{ǵ ;6nAQYX_j͓= Իqx)h4WWeH"@}hi>>r;s>$s! <5IJ)Vw|R[ Iԛ퍓FQ=)KSo WTW79۲[v7@ӊP5:?ܜngOCm2Bs)8uC>^u>ˍqe+6 k1:i$Y]AZfMp(9>@#׭}}ٯu`k*%Y<7I _ČWϪVŏԻWvS7XnnV4_ܜ6~퍝w6>eKVב}k*k" Il[߿[54:#Q@sSo{kϞǘ/qfKxic U}t4$TS%S?opt/ǭJ`d8с_9)je?qFT)M3[6vr#ozt[dW>W.\oZR3 #Zt$q O,@{ڤ8o\0?z%>?Wѩi[OuGjo_i7m{;bo=Sn*.nֳpt㊽gj EhP~0[hVhLjCO?#|8t'p޷${PO xZtuDM9Ύi[q;;b ˘j {pYHgE?W0J' /Rkk$d6ź˹nqY-@Y}+@)o|?j/=s{e[3I c3e(wmrPd0fM}r;kP|>|"/-e\{pٽ ?s:c$juY'4Xn7Fԃ^8A/no~{=׵ڬ2-JiqL)+S_ {vA;{@جXHe}DW zʈHϮU/rE:TLZ'yBO2owO~FK,O<Њ(N';2u&vsk|Cݮ'ا䋹#/}޿{uK?_?_e_m!䭵Dӧ?Iw]{ߺ^׽u~{ߺ^?O~j#hsv5eAAOԫ.:'\7aTeX/$*Z*sRnfcL;~|B6YW;u.wۢhᅙZ@ iНP* x޶-FJn`^KWWpu\}]DTS.HxP3$KCǏ_SӚ7':o{ZGUBઠTKT^ݕ~81N~Rt=!7fW9T}És0TL:EE< 7}kǢPEM*HԟE_w_h-FdxY$IX,+._D3(V+3gꞅ~b:rmPͱVa1=56.1YKLyz !!Aa֛Ln `zZ>ycʶ篻7"͖oۤCH%3J!aTo<)JPYG`+-"]CSw},Q7V뫤*h{d+EDؼGD})6*:Ռ嫏 q_hp_x-qtD)6@"RhP:CKT֭wZ/Ɇ]3pgp-Ul5j9[+;xڵzP<]Y" , Idw+Pp5Jdeglm,hWG/hWyY$E! 5a?VsNKW{scLkv<m^bfhL~,M-vVyM%MH-}r{Gmf"x>"9=&)+Uό{+H>BtV|DvjE.ۻ_1qtl&/("zUhrѬRвM ax6_e*}<8u|}ڽnQ]8bL2J$nQt e4]V[%Cʗ>&6&ܻ*vWɐe3xٺWc1 RPЉjCS.%]ҫАKy z?mW?WteGD(*I@4[7={ߺ_- ewm?䭺D뺾ӧݷ??k/r6?#zu~{ߺ^ߺ^ʷ'oM=/Ǐ]!_[oqu˜4y*^:xq; R4h)J)a(n *$K];5}eceI}m6}*Zg8`*|)oXְ?2K?3*8au5;$ºS-+* u[5dgCYN*JΔzZy4D)?F&<۲7{2,rF >1鿗YKk?_;~+fKe03GOf!@ #Ŏm[G&HEOn9k bI uF̵>b;m>kn\թd.;%VV $yh]w )v^HylRZsvڶ %/m*:.ι PӖyST}Ul\7O^ X TT9M<\1AEWWȐ,w5lwM+H>d=3}RE!A1w*CHHjv +RK*v#=V awyܴ0&i*FB "H(4^]Oש5D;h,Fl#"6clƟd1{mA ۪74XbD2oAI]m JzpΑo6w((V *N:u=_hm$g$Cu gRJ*Z"R5q?'oOTcKm`*-EkmX&o]둣9j1Kj\M-EK(Eb]v;\>5AG%|EO\:rnG' q*e¤ jք[F*GUu/+omvG+}n]yMin& JUhuR8pl2j4_NTOz+gΞmr[++$УG,IR,ԺI QS&7i42FHbVXaRvSӤ!҈xA'cUʠL}Ii uK[|E&䞪|={`D{mެ7FK,lPr%#(c_"q>s7/7OۯX/q* *% oi(.ُ$$qƊK1 .};F7m$G^ڳSj"痷IS5?. 4a!lvYsfƓo &) ۛ5^ջPQODOS:ď{[m1ˤ/ \Ϲ|͵CoW{:JGd5Gi5PSAOG۹)kT~J:Zm6*t-;U?ۋa$ҽ,EhThbE_.߻??WÆˠ/vp} `عj4_7Uxk50{70SכӲ#{o/4;[ [N3 G-}dX\9^-h!>("n[x*ITWM6͖HRtWQ4,p:}[>AmEy1wNj f*بTIG%E,J3 Ԁ~m"!dUZi}Di. WHRiƄ1ҧ#>;o175 =Q: /{?s8 z,v;pK_DS-5<<ѵ];S}mH!qkH%k?˪[ǮWU4fhG?P?.Gb|U-lxܵ^tZ -UM):w}I`WI[8pݯ`ͻi*^(P$PZ'I\+ mC>PR6[T}9N~Y{;Kfj1Ip=(Y):0P;e]/ŤU(^T<^NZorӕRkyE 2B Cl{~|Pݳx.wtGQ5u53Jm: 5bz}O-21^jcvf[8oـFǟRV/p6;ڏxmK ֯ Y{xuPfeb|}Qu~3{bBhr5=UBg5Se0cȢz:0J:3 ,-[YCq_C#Xܡ\^r4k@EUC)]U:]ISC{ɭK>l:`g=K'eipz pO$L)@qRy^H*<9ά[_P\w[M׏޽wƭLPW; 5%tnB JI mb) ?zÎa7Ǘyo{]B%[P*VRUԆRTВHxj<7U|E/*zqTnj*Zz[8_{TQE76[#AەuMJ(nM"xe8gWͷr._*MgY _ݯOtc KhY p\舝J3#(.C>Bn.nj]>*FUw+'Vٞdj(ڄya+qۯ'Xd,@W8 )csq9?d߶vX%BK}^`l#++&C++w.!r{+n/|hG5{n8z(vD8ܿ$Mi/>q`J󿠾|}ٺSmG_b5ob+h)҇%u}TQQ暞]k=rOj,} 8+^}Nˢ5]ˌ蜟H!7w[o7tE4MCHkh|OhA(xךv떶Dw$ 5)j\Tf@揺\2nwaq~z?s $!QώTb+ܳ2Л&uߺ^;N5?bF*: T\4gwX6 s`{x޲%u1ǵڨ~to7 kKݯZr&?|}7WU+ŕf'!X9vǴ 蠻s6s~}g_>>ڂs?WGW?C)ѝأxNOG8b_=Ňnz;cᶿuE XMI;n?￧׼~_9o[R9'#ߟp5p}F,c:m{iAy#WOֿ xse{q=PmxG[C/<n1M=t5aUF1Ώ|9k96 C y#I8&3/CPJd_9:#aϑ=0;~0MPRbgdl]ͷ%3Q=qcaO{tmD'H4o57̧q_w#3'VHƬ*;&ԜU6e&bsݙ:{ݟٛZkK~۵uX[35ned }u_xy99qXhEkKygẄE' C𩪊럇T4K6i)樥l($O:U u Zuq%S{&d: Ty=(?Bt|Yq9ָC;Wfpgg5f bQfOX%˶BwE%yaQ _x~r?i}f1oO[(r*iA_ B/_co9E| l6w [ci$hf rŭY˥`f:OB'F~rfߴ{7\ulk>ΟR!3%ʶC< ݯa'>J`qǯe=4"CO[1$K*$ry.${7TvI 4\Sah.ԚyS=|`g{_vIݕػ'`m͌۸ݾlm.I3OLuĮ~ɼ|,/KSSF0Z=,qLu)۩?۟߿O˺tܓbKvG kMB9tIpȬ 6!-cN! u.{țf2rMXvJ-VH1Tpb_Οo/{'/.O)~Rdw.JrgFS0 +5.EPmg4Br* O|/>{gۉvKUc;[aBG|`hh(i# =ېE/mqr|t dP$fbFxͅjBJ K?~;=/pyVi]6)UxpWjU„?s bT2;U-`XFhAxplG|N?3ҍyehےRͼ:bk*xdpcֽ/ۓiE-;u,{6Q.=ݶ7$4 V"!P O@ Msu ?oY{;>`|v20pEXUY w5wѱ<{@P*^668Tj+V0WFg4_!**kp[v  |G;)uճa*aJIf2U<{![bU@uJn =kcɶk"^mU)&P-{_{߾^j:7vP#6GqUlbDol㖖B*~= cBǴA}ʼU/qXهÎR0>c/}vWfer{mI9;rس} _Ck.k\{l!mtrX0SSV5<K{{_ۦn&մIGu*}}>@|!g꽋ٍœp45}[Z3wzzm}%]pʯ ̷{]塳Zh(ь `8uƾQ?C}B.P/?C2ʤ|w'=[jsw6{꤬|9vR1< KI^d KJ[Q7>VH9O!8?rۋ[o@lR(3ݭ;vosW/mC,{K'ZT;ϐ7gTϳ79Q[+=&%zfiG-f_M,6.!V=^ocQ1DM?窹=:݇yCY!q"=_KsIj`:ε[}bnޝ؛a n_mzS,`duD]Y!]l ١J*?*(?X+ލm31Z Kq!XV8U=i G [)] T-59RdmL2W:[ Tۅ2Iz};vy)coI$BpTڪ}s{^ߺ^/>/U#w_j#YEJ-HFFRނ/o%\2\ro(F&jJ e1|z9)SMbi[2P] a!UQ2T$ {n,mVt=v!C83XH%v&zʟ ?1_iVӮ}?Fﭪ{{w+xýko _o.%tu0N Ww??}.HLзsl2=A]}awV~i}ɺ+b8* LMPor&i")1Թg6-?Wag.-dvp+QF*xHNiAO*s<wGzg>c/RwCJׇ:!bj}4 4x :Пe<-J}a60 ƇTw+#**ntt⽹}I=pyS6oV?Ou_hahpIGW?cy LEoa`%|M.5>5]6[r,6o?a\ۛo}}g|,5OνkO uOT=?w#o<ӨX;O5A5MEMS>"E52ܔ!jMk?}e{y[LI9ݕOAuWd3114չ hi RUUgSGDVi` 4J>-k_}8vMY-Np6'go/TNJ\evle 㞿u&:I=->n9ڕAO/6%_KKU^Ic/K&W/'| v鬵|H2جa!By^1ZDaxlNCw2+J?h,Пm>]K@(rx L5(jJӪD]VWQL]=e2HJ=ydA}u?wZ/zt4?^" hq*h)x%uHԹ tQ~Jl,FS箭{M+"Q\eA:u9ug?QGuXp0orޱ쯷5z߭ӿW &,?_zP_nQ!~-^?E웞;Lq_Zxar|LC(TRUو,޷Noӟ])z>RƾUX [Ksqb绗8]WUY?;*tP!D^Dxu597٣-zï{Ǫ8ϘlntiZY(yGKeƜ%j߼/9_q^n뉝|~bq?[ٻS S?=wې܇J˅?go- 81rv?cWouݒ\ϑ*Q2SvʪϢQb>_AmsaHk]u{i)=nSN i_A#O7wR̭ӘyӇ񇪯T k秒Ro* 1xSd}|!S!L_ޏq'>TDd|}V/Wx{ <>CiWjod-/YXk"<0?qWiL?ݬ}z¾{ߺ]q׺y1͕Q>>cmy8~G_NLŃ;/vO,|fٜIoQx;?빾q{uzhq E&ƍí-ݹ|7·Af)onF.'wJf?`a ] %pjOÏg/L\QMKIX&e8Fv.׽tD~h^N=kyZ8+?䍹S;ui3/ux_pi5W<:/6ʩ/ =٢x%dY:R:ȂjEOQd$ &G_lAk ?VӮ}UNB^p G5m ^Su{9CHV>z/?>ek?E F??-˹I֟_}n/<>m)~]oW=q9_Y?E½d7S.[| {+x׹JŹm0yGVX^NOu~ ;e~fg=-o_?p?ߎ#~yzs붿nTFyiR'#OC1PL,av /D#H)H%F &-6Uag.gyQj~gc#,[K^)مun0 ) ԥF=̜/6*~EOSMwS*|p%( ny#W"$hPE?h9.ڙiZu }I[RPh=HSOE/M=C0X' =WVby#N^u/U#E}%mRSO=jOʕBb}_ùξ7-Y=’W?I`O[N8 c j\-&E6']y aE#QU n_xJnUĎ}]5FGM]W TD%AuZvWζOYK*=Ż m:G<~{c]ɡeo }?}}p߯yO6WOu_hahpTU_{$"S~; LĒ$c6-(>$|'R!X8u)۩?Pn+[26~ië bme-Lyn٫ed*R*h*i-b#*.yd}nGc3.Okxu pT΋fZ+*(dFHjzaMԌAɳ6h9+KSS묌ݽӹsݥ‰7m[F]\1N/xf/(w>bGjc&8 .AK NXʭj19 X((%q (ϜkYZ/"0Oi˞7w31'ԢTPiG@2EP_Yḱ⪾B}1q3oO+7s7(_g;C-E].߆Rq`?v:)?M- S,].n޵VDzh*?ϲmK̐{ i+ĿEp".%2uߺ^ﳏ^ERČX|PK7^aY܌0 nUVql=u!>3W=>A g:m_ QJ~jkS>[oqW3;" 8#ҭ pKy*) bMZvTQy<[iRH'bȒ--tT Bkk%:xYo rV.IMFӺ)@=MT lH zqtpl꽉[ܛYX=OIV TPg_u|K :07\۾]j7~Q߷^ZmL}GSAHt~0EEoIg=CV$}h:=.m!*" ԵT zQO'*Agn 3'xu_px6"E#"B_U}nOpWU_-gZb}W仸_O>=O7O?uKܿW?ky',]?T.F/_1_+%>3MKV]˙H-=si㧩#1 =s]Tծ"#8zMw?7_ǰ%d }OsW=nd'w!3^+i\Zcy:>ճUp>DfP~Su VaY !׽X?Nb!v`LTU_)>oԟ՞8u#~xscA3o}vwnҧpu78ZJ:}{kAqɿDj?zo?>WZ[T܈~?9NyY?w2}?jԳ9J!z{hƲD]ZHHI%,/bU܊_?LJB?S"$/M>b쩡1ڛc)w>Ջ)u|}f{nE9 /QM&CbZy#ܔbddS"ֆC_>V^L3cW`5C"JjI$ d+OsE$6qjh%w_[aie82*.Nl 4;|Q]z5ϾƤ%o+?-:ѧa>o>͏KgO9rMuV_OOs\:콾n|ͽ=O>wW/u⽶=o׿ly;ܵ_Cҟu?/pE_K9.ˤ"X:Jѫ^=AyZaUAPZ#(9/Y'arI" D*q'$P @P''6 4Y*655Ed!A2 I }Ȣw?z̻lGiu*߲}l۔v÷ne>sŊpahzLE^i)JKS+I;bIPI$l#P]#"VZokM9uxaȡuJ @ d4,G<Ѥ RX$ʌC+&B:pj 8P":GGتz }.7PGOIGG.3PB()X(h("Gka`=*0%GW$%I&ROZ:Oݭ} ~G7^A[}i1 5^ps;ѱ4゚JڙȤs70Aqks)}{ӯ7&ues;p% y}yh4,OwWVϱl)}W.uՋ s6 Gʟ%OH;swG$5X̎B9ntpY~]v'ڹn.\l;{Hdӭ_J VQⶮۙ4hX̝%G#V$2JI"񖈣.i8?\Y]Xu)$`10Ѫ:)?̧ٳo_>!{+{_Mb7^ߺ^gws>d|}/ݙMw)'9 1͔ٻUVXb49UItjTM-Ed;;s>j ކs7mݲ?ʹѓ4-a~=&8׹2;/vKbɎ4fw*4qݿ1SEWI.9B"sR\%u|,m<۸qN#pQ VݟfeH>+w&1sgMC=1RU҅E"~ڲFH'=\}JE Ɨ?lhA9b9nҼ۶YGuժ԰AO*q}ܭQ*tAE}&7u|̩ {+ޯ+L)#=udq#JkPH)NsAo:=I"Zۍ0}N&M,wH᭷J6]?î{NM{hR=^mίޅb{9Kq^IgiS'{ww'ME![{?ϙEsDO2%d>ʹñ;ԩ?]^=V&cëY0;'J2*Iw߯/$}s/'nA㧮 uO?sei1u^wzӯg_CTO?C7͟4c_ ?K/֋?΋6/y1avbuURcv*L-M魁\Qhd贈*Ia1Ps-7[H" Akcu;˻+{5{Fg+ݴ̥ ^\b ׿?vĽ rnvH|}7U ˠwKϿW!Kfg7܉_!CSa7YnM]T?R|!ü$ q:o?C]e:Jg$.Qʞ &DfLqi)ci2XºzLӏ~'Kg=ȑ״3N|A'_NOs\A콾n|ͽ?V?Ou_h{ahpol͈Y?)gx^dա/C;5gy!TƵ6$re[v=4'=rg#:pD%ku)Gq_䰟Agܳ.nտV }F?-EȿN?~_x<Jai3XK_z]Gro;Kfl5~;Y # SUvFvX႞?6@-,pG$XTSl7iڬܮ$XgwcEU$sK|۟#3}5te*sfZ-Ϻ.ݛ%ֹڸ(᪊TK-D-,mw5m{s4VLrx1QşG@&S'%9/pbrXxHhΘԹ1wB#Iߢ$GћR,6>4:Ӻ+U;ð7!zvto,H::$s ,0lb:өc&Xp[܎i?9\WYO׈Zm;}B &ٚPN,?Z4`0ʙ m]KfLy7K\lg߿Wٯr$e]eƊEO:u7.aC3Y!NORեzn~ߣ^ZǛW?=,TG*s<xwGz);ϟm C}G:(_+?S؞˹JG~H~_wKhzoutW72LJXF_yh|<ĽV[q˿[]ƒҹ:VOw?p뼾ӽ1Ѣ \zyZs>$}h'\m֗ϋ.{΍شة#Y nlQF۷&v3IɺaGl۞up9,~t9YN*LJhTF? S|U};kq ޙz[MI,\; :x'bi(apTWTƳİ.-' yO Ǡ޿ˮzT2FQWQG4Fd)gHRee VVpUOr)F}d׽uߺ^׽uDCpj;X,W *?xFq˓F5`$^]|Ӳ AB,Y}IWθ]eWcfS˪rn*"MDzQh+#CCr8?OrH`潤WG? KeTUՓ{I`orS۠O+yLUdo"c}ͷ-D[F>dqV?h_0{oMV>\ݐ[Hر(NP4Rƣ wnor?Y?Eܿ-z,8|\XŎc;Fkxuqs)^^羸1ͣо[~߳lOp2sqN?i>=y*~Bxj?Ye-[ݹ .$CĬJ(n$r,O.u|I;#W>թfW*?d'ůKx}c5Ow++_=Ҿz_LWn엑q<NbR 'yJ\GHvR:uG Y$6 ꥭr>O\9B2n i*|ʣnb;pX6&g3O#ӮB 3*h!>7kpFO]輟m.Bjv4JOҕ+_Kq)1;![8IeRQfꨩ I48cfҊm` ^ Kr=%بnTg88\f۹Hpظ\2C_J}A'*qn;Yr9k.]-+sq 3P__/3ԏjvƟan__!5a~i]Ou_ 1t`:zϧ[3zbnς!뭣Nچ %}tx-b㬬M(\đ\6[G[Gw|+ܹx܊2K$QER35+A֩"t<,XϏe*ԳZuv%, E^Y'bM ?W~i Ǻ=:W( fr%$TTz?3jPψة>TakOd7O!oۮF>^-3-SJ_Losw\L~n|ͽ=wmЏH>wW/u⻶=}g["wr^.4\ N?(=kWcK 4-}?\[o$nŎ}"_']ozǟ/<Q0وXKUSm˴ˢ.mn;9 ؝,N3o7Un|FBhZʵXGsAkbBVoZi0I&uqI7j6ڢ$9A_j*J rY-F>Y֤YӮ6=ٗj]s٪O<'7#" 7z9j׷hOoZ~. _ʛI,qD :;4/ȮhV ܪFo'؟{?uu$fJ!E?!T >ZZ(yGKeƜ%jҿ/9_q^n뉝|?U?\-~ńB}0JI_sV$}h\[_Nл;^ZZj"l厦p:an -,)S-=]9dZ}Dַ6}'r"?J:-܎`,3)4,HFΉJo?=w7EFK$Q,1aq=A+B+ ܻW,XW-] !TҢ%YJ3#);> ǙݵgȽ:\:>7ohp4I7FYۓʡwǴ'DSzR6>t u{`-}=4uˍ@g?* a0xm@{ߺ_ߺ^׽u˯uss_{ve㻫GKڌa,t(uQA s&68֐Hu5j?&ug> &dZKI]۴.uaox|y}Y V ?&Bޒ sȳ2pW(ɏPߗjoKz+[}g|f?n#\O0rG% ~x~,tݱa5<:׿/_U/s\*)꿙ˉ)5޻^T6E%\ (EI"2#)̤qc::7ݥ=:~SL?a|?W $,?zP_nR:zVM##ψ{J#a axr T0b>|4o_WoP+o\:G Q䘚AO&"wwZ3R'{SR9*Jh%/9#I SbFɦ>Աtre0+Hʣ׭ƾa$|s{܏:h?tOn'.l&.[}{l7?8}=?'OT?wvF<\:Ƕm_3>GZg UîoJ}`psM <2TKA<: 0ĥYGh߸deVvTE%ɠ$z ?+I~2%CQVPTYK?G_ E; 9dm$ٔ>XjSQC5 2J)U`A#?fz=WTmL掛mw\x㩭ud5s(*ߋF=O)CJ}A(_iA?%[?fG+ c!oOW'['quNϻ'OA~HR&o%xFs=gg-"2Eؙurv PE?#~Q򏇟=Ɯ%jo/9_q^}gʿDMTu>ry?;56hfS@>t#72P8/Zp(yGKe%jϼ/9_q^n뉝|/[ϒ#x=ۮENWvCWk|<Cݮ[ܽEx_}^ªD??9Y?wp,@o%|+38lRA|rG߸%fAlWz"7BE'%rU;_tw'\5:P7{[+QCL1}ѿ,j!?_w߸aO] ӌy:K{_'ߐ_>eg^wQwߔTWՔ1? \zy\c>4-Oܯ]]5,꥿gSV{vn@'cSquWإQ㣨chX0,$ҟQd>uWuw/uomKW2{@vͪTd@;>v|n.[3}sc7f[wzmlesXx $b) Z!+ڒ# Gem[˸$WJ8ʱ6݅o2&:0Y8xfr5q?A" S/~b6ͻn=VXXЊNpr2GKn]ߺ^׽u֙_\&>#.W+}2ck .#r0 GKvF"뤟q;ߗ²-[x-/i"XFp8pctk 3r~a2$%-> [iGq'R/27M!|ź8J_?ݭGvr0rG}޿{uK?_<_W??cC~nQv_wJkF z9n?9K[=vNWۯW};۩>+qro)\~ϟvN9mo痮}s ;z~?V#y/KW)lOe܋% ?O/;RiG_W>g{O\"b׿<6h}PoagiܿOu`A?7PJޞ II=p/{öd=|~>Kk'eZUkͿs7+?u~Oڊ??5gOjidR<D,SE"VRX n䍧t#niQ$W8P B E)D+߉B8%;KyHV5TS$eB^Y\1$O\=)7|}昷~$ X`ON;O4{w=o+ϟ_+S}G.:̯4:[w=\?{$m9o䞹,׽wM<$;d-SQ?^J~$Pnޠԝ]0fv47"xc%CL:L{_*ߘW?)c~nn#_g{`њѢo&u-$1E^ޥjf䑾#7$s.O`q7wܦg,߾.FI&Bϐ(NTTOsM?C7~{J6t5_\F kM̫U8fC6vQfy3r%U"ۃy~c띛=dž7 8֯*\ҔRy֢P7[[ٿ72LJQ7-=֜3Q7uYoq.on=ts NW_W}:c{g_- ewm?䭺L뺾ӧݷ??k/rv]^/,8QO*(?9Y?wp,A%goD;;{9O2iBWK B J/V\u ; *,6UC,j(5u#؛ 69n6_|vQ('˭G O}nr,?yqΥ'*7ib{Ȣ2]aCAb"_s*2VRVV*A{bp$=|ko.ͫqk7ߠqdqƥڞEaoxp9h/Il-C#y|+Zʊ*Ү:iGWS+W"TT}B3Rά$Ftuc8Njxq VủB pZP4PPi⧴A{1<ߺ^:Njy Vy#ZjHjw2HX^Ͻ59,3@2I@hC{M7** W(4%i'Zj)zX\x!3wmmDx}t?#N"ߦm |ȿ_`~+>t?vimϑC:f]\iFU`?~'||;3Z|5u| <{۵a!H"_H/>n`,wHݷJ6]?îNM{hR=^g?SGuXp0or}޿uJ[$Ti:9p]-P }8Q uU#,#1fC.`>Lk/\N>sa-Q,yE|Z0*'Ak|(8+S1GKUrږS&j svmO9? aSWk?7_>@M3b{CȿP?}y_?[iT`R$2Ua*SGPQ=W NI I Պ};'E!럾^qm!!$߶4hpJ+T=|:zfi*_*A$Uʌ4rFH7punm]GhukwH$}ЈxS_Oϯ?3?}wO8q#/zöd=|>Kk#eZUkͿs7+?u~ S|]'ty?ԇ=l?b2U_|I?w^< 9O4{w=n?9]+zʏ}QgK2o?rۑҟn#O/?n?I]R({wt=!_%ky?^J/?wow?\L㧮}?{<T}%:H|M)5QqMM:QM߹R #Gvc?R`;/}z޲z#NUE0+ ?? \zyjs>$}h'\b_֛yFCsi;8-eKz ż߿z دq= XW`43 W,P]IcH&4^o^E ??~NP=&yq_2>ŸX%d'_K;x}r'5C~[yg({?wt{[ٷ72LJQg>^4i1Rf?8HL=W-")>rH/cRx q-nӯSE~od}ÔkdrK"cl}|ndwHcܝJS:O_ڻd$IVb3ynmrw?]h)`$d4@ uAUبp˛$K"Kл(.bl?DcB Ȝ_By1 fG%O\yvܙF:@袿>PLxO?+^[b(SV嶕vsUSe:MZmOM xkʟ<?)??T?XMVGV +knKSjbNr$Q?<οXҺ8j?_w߸aOYiPu5uξO }w%5r?Ǻ)ʩѾ_JÊ\?QHz+(]!VuHH4̓*ʼnky=߇5O2u|($]ث#Cm3(ɭR;IqÉʝlquk9a?rGsKOۯX/q:vǸwmO>ӾS^4}Tǹ jG1UB=AQG\,Rz@o[: ofXvY>]o1w׹O䇷?y~~D?T ˠwdK?jԳ/K.>@ߏ9lOhJG~^~_wKh S|?Ӻg#n/zöd=|~>Kk#gJ<:6ʫ}Y~'*O;ݻ'ti,[oCϾĽֿ}VxvכToW՗~Y)~2&_,%͋ڔYQ ̦줨7{ܚ6})OVѯS'݋~!K*K*5eQs{1Xn1R}kcۇ Oz?η>"UHbJկZ£zvSOSoy1Q)#hd; PI M /⪣yGpW@OX~wW?׏Bi*sex"u>%XݥK0ɚA1eoNe12:spp=]hw"+K?aO^!J/?wo{?]zto=y:K{_'ߐ_>egW@7x~Q*r?oVS_ 񕺅Rb:xH- ^9 hx5쫣hPKv˞04~QLңi_ϭ2?E?U_4/-4tqNZ7_1~y"4ogFEiafK@Yn/Y⣍#+?W|h} 4 Xq֌T\I|W86gHS%\bbyR7KV/]HN3Zu+J=lՄ\?B|d9ſOO7KW9𡬬ؔ H,\ŃA[—6 L:\ň.FslZ++?)OgT|Iûx~Yc=t1N3Ҡ-j닝|~b\ŎBk?x_n?r)l.Ǫ?#A?:o=]nN [soW _q$=6ˎ_)"HǺ0ʩȟ;/!"~G>?<X ?wc~i$g'*ƿ;/'kx,;MѼcyߺA/{My6\+o+'Z_@a}yI_}^OL?&~c7 z?Sr!A;dC>5Yy+qoaTd7޳>m:ݷm]21xt>ŤژNMbUcKE=?~ɳn(> b}-HzxPS8]Wj*n0Ew*>om5>:oa>ҖѥGr}o\f'9|(i*IBIYkUcEjJi!kݢe$+>ěnݜomrf]̷T(>zhGʇw߹c䇷?)~cR9?c7Y/ RtU1[ܸ ڤ?A%|7bU}۪mR?+e6[zrΒb6=|~upT3g۸}ՍI .2|\20oFI *.{eϛ̭Oj†G%#WEx<:Z|'1k3d;s1NPN`n FHƣ$u+(6>Mō <.wߓX ^aC_ˇ2;O?1kF_54QpۣYhIFl.mܐuF뺜o.˛奢{))Yp֢#JӮU|cv'KY&{kll|U<<vK%E.>NR 4J"طOGfQ <}6_{(Tygcy^`A.UmO:5^Z#z,sgbzY2|Rd-٣vAx4=pMpvPQ&tB00UA:=ZCܽiGYKcY^{Q__WL{:TS +knKSja^r#$Q?SοXҺ8iebsy(&M)-3Zԩ+M4gmF&mW_q"ǼǷ'Nnz跿|ۗZT}!fJ>}}8oq]|)>mB+wan ]WK28 *aUux+.&e,|=}ǵlMQ-V.@0<($uS齒zר\l}\Ⱥ`Kg.oq?_sʹBkx~ 7a߷i,',}hs 'dnHGzYQVT*h&jZ cֳbq("4]Y#{2]H5Q*ql ^\q<\y/#?o/XkS,[osb7ZX£wŽ`3A6ʬL x_Kg'ekK k^[|`[RS|>}KnNnc6CrUta_OAy\uC1Q T &\anms?Ǡ߮ W}d?N7 d 8R}u:`?K{n|;/bLbԐGU6-Z,nkAI6IQ. wSi:_OGQ{h$ƋNj)QI@XoBv??f?^ܳ%OYDZQ:K{_*ߘW?)c~n?PLy}Ƿ_24]}?!x/qq_s>$}h':o=]nN []+z̯}Qg pk{g??}TOXMVG[:}U?=^+g}ٻ-<+E VG 0hP,m̭H乖4[M*Ȥ|LVe_$*7rY}*'Y?$ydߛ~] ?/Ic뎺݇l=wNQc 9[=S"M 5 3Ke3O* 1QK~@N߲o[ӳۣ5P^%uEK |*yZM-(t?G~_P6C;/'kh ,;M֨8OKgWNcnN,jzzF\+$B0]2r U>{G/H5YnG-@G)P1n,3jT-.naK2*c03+xUؖeQnH#($eYOwkclfQ;Q_%lM~tO&Osj`Q]I,44c4Ԉ,ďL ՛篠XR-$yG 8QEX`TgG6꾖rvS +6ژHjt㾨 s_OkmF'\ }o[{}<Ҽu?סGڎߺ@NLEqi $T㩀!p~M^!s= yJMM=01Jgn6 ~]o,TtBkܪr~_p|N ]~^Xk֝LN%﬍:K)ՐÈk)}<ߩW?>ە)n_UQ7S?a?S޳>m:)p˄m>-5O-K#MYG;V#ꮬB(Gc?U?'wg;vNpu?ql|VSpŃA9,/|Tb);oD#Xi륅EC{}ܳG5jqt| 뱞ݵ[sA%՜α ԀdS@ ~nTb:~1inO5q=Yceu.;(&zfҪ+Dknbw t?\Px>{us_5#s4{ZSRdIZ%VbxM8Adnõx۝kn~YK 3UdBMgaTZ(rePƍUrr+ZuZcn/9ЛoᾜJ@SBvSϙ=-ԝ > ڽk2}/w1WFUPdmlA;qnڝ#E`d֤VSӏX%ߙ=to慒m.RJi)Шd'HUO*~gc &zh4FVL҅3^8 kfڟ%>4ma rVevo=ܘJ<!pLT龁C(<VG 3`ضN_k{K{{"lȫ,7jBC1Ie_Q-ng5]{|&R#wU6 hvYRYRˑ 4@֬ 2ysm $j*ڨj;@+!}}%z6ͪ\\Rq4h,<8"J/]C^zқ#Ifᤖrn}[5<Ɔt53h̹_&s_.4DƢ1A\Fyfϛzr"L^"4d4qDaGWuMBfc oBmܻ/ĞO6s+u)rfj$n,fͤEn=_|r"7jii/Xk;#%QScNG O~yUyoipwt;84c-1e@O9س*_ϛ9=WO_9\^·qu?\g2ޛ E6.rؙ lm x][[\\Ƴ\:$wIWMe^$uSͿ'bn.4i[Uqާ3Q&bGkGAD;JJcX~w]|hM~_>sl/vK.euM #$iJVu?FYoZ"0{Mp{D(}]2˿20} ɬs`v3r,q"MVE_km\}=j?CNj5:snv1ַ;A.z*רXzL~rL=\ (m6,1I,&9JT>4^XnNd3Er V#bY5bH*xpO37^^nb ܒwTd;g\z iX\n8gy!fT2\C?|nPKA%CBT0A8##^ɶ{?Vi tꌕ].@e R _n>5鄧Gc7^|^ vmm&]YqܛCfjY DFוژ J0Z\*+-9E쥖s51Ź3b urkv.m9fLIuuJI%UNh]}C\n龬cw{Yf L9- <lvʠCu]Ut0ǐ$hX yk6  OZ$ogKvV3o&I`a$6 |T%fBQQdrU[rn޽׽a}/qhQc~}nb/R7obbDZAO["[`gQ5Pg7Ol}g>[ 3 !"G%TpZl0~sߟ#~ TulM&Ӫ#tTC'm}Fb<-2C!R;._z^ xiq7rlLQQ2SA:ԱMh,Oim>>5n~j|pؒSø{k&,m+wEiD}Bh,{h֟P\5 PC^ 7͉Kn3ᴏ 5xӠ҄փg8LMQqNc21@d)w%rB2Ò`1+\TPʢz!%SwL2ۧZs4`e*ch?ފ|EԵSCL;K*ygmD'r#T4Ե4@Y ph]]WrDH,єba =g }U:%̣Z?o,j Ի{!be0-r8Jl~G-e,Sڀl{o,K!FFH5>?lWNQCwպGY[]@##jz?5~7OQ)~N7T3{g+n0܂|o`rUFsb 9w=wEžRB)P՘q54zWw~F-gGv3F|ETƢ($HKG*o43{nwM'r^zX^_xe)1ʖv*=d߬/u1t@ Ak>ai^!/1Z ?,n zdIA0*X~zҼj@jl\n,a 绰{p,:7Sv]Eہ}vR1)g,=pݖ;eP iCRH8WuKwn{z{ lBI]&A,> IG*#x֜Wjvfv}Oí׋~{ڈo ɒ2$|DgZ7]aCiRm9y;kwfƢM>!G9Vð{o"ZCojDֆT-iSN=m̭kO,@w^K^nMQ6 :ob!fb*fVCؘvd-]8!1E˃4PHS}{o{\Ż;5 9D4<@<4f5pR:nN. ӉX}ji{ϩݹ\B%T5[>*)vW'$iZ@kmnFxaƍZ))ǏY9'3쭗2Zۉd,"Gj%?@E3姻;wtjNnۻ_x_]y ڻ>k۽U>썃&R+W#EgrhrUTQL4_rO1DTJeihE|îzxܱ l;u}D uC6u(} IJgo.ϟ퍉۳[t߫{w`mLٻʭn:}c6m rL7 i|,Ŧķ>){c1ZLȾ{+om)fF{clOi5}>V VQK%"$rW4 lh$@aI Q^4d?oUn -?NYQeICRDBTFh-CWe?i(̾N!~Mapmcw9]Ow?,czcu48??{^Sؔ=ݓ=vwvRlL#tPO^kaf(6Y1*˫j* W^0){nӵ.dv><&+Q5WUuiϾdv}v }Q͐=VKE]ۢ|:otTjgžm̛ͼuYxՠpu d S8{w{?̻67\Z`pfx.DzFJf~c<|fۻvwy\~K3OYXͫA۴;se3|P ĵ"TSWn\qwe5\y hZ E@@n>'s{M)mӋ 2F%M2Kk ]q?_^d:;[aoWvc${.FSkl>jEM=bĔKOLybk T3%嚒xo(rɼGMu[L%$вF!,RȨ:^ߺEG_W>grue<.D/II)%7ܘﮨ(RdJWys*ŗvR 1jbE K#[PkwyP23^B3 Ӈ9Oz=[?oϟ_+G~?I#zlV7T5/PxX\wvd i^à!\]G~$g9l:>3^s5k+(L/:+>>ALu={뗿u{8S|4Gs~|lJ^;@?X,p݅"ٽ7 sjf`/~{ߺ^׽u~{ߺ\mk׾/~{ߺ^׽u{6qx}{~{\u~{ߺ^׽u~x=uӏ~>^{m<:ק\~{ߺ\-_߸^k8\~ߺEG_W>gܿ4_:z{sO ?sei1u%zY-:/Q;ڱo]mS]z^>ꅁȒoC[AQa}6׏=4W q0+cjˎy=Z[£v6>+83}Mutb`f(zs[$UQ@n"B6?LzoWo>U݅-!M1K sApSZ15۳/hԒI%hIpnbXZ@-SpmDN팛,T~| /$w%jTfdfsJWxʝrۯ{^׺u{8S|4Gs~|mJ^;OgK2o?rD uw}[z^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ_ߺ@/ʜ.cr|`v/!0<&"|W1ubU]Vΐ hK#PIKgERXĒЯmo/'H!mUD[ٙUA$ӭ$>~f$o썾?m𴴹0ph֙v?j`xV]FOYQKjnmӖ&ŜGcҵRT>Ν{y͟{RWMUA_OXCxr"=t vt:fC JnuRJմE"7-ujN<--4P #)}r(uWM+_2}={]pҗ~ӜmLؔJigO_4y殨&fSWw[ŜE )cW]7וv/`۹y+Uy.X荦,!Đ"O[*o_+srC~w>Ə- ka^4{+ RSYjjc%v l+ 07u9+Fi/}f_wy}>]O6xA29.|+Kxz<׺u{{^NT ?ߟ??ҿWG.:̿4:[w=\?{$m9o䞹׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^ߺ^&[sx಻_w`0l(P0Y| rXY7FQGʁ"PGtmn& F쎌82:GGu%_}sAMQڻô. LGB}Jo_r#nP&uXamvܴAiYaJYZk trz'x]ҝuPA6Ni ,jI{tIpPTTk{1]6v ?8}Nxn97SUYdf c8k:~{ߺ^׽tݸcjnlFϔ٬v([=]n?9:V'$VhQJtNZ\_Ms#IE`^?{Z׹kduqn|gc={KU-غ-62+Lioj*<I`kͣ{)Z~0GEA>}*Y0SY$a@QH7%!^e;n Os`. մ]ٻA.FHS6VewfouN_V^Ai#<`z{h [JZPv=lUt>*?Ҧ!- /L' Tդp= SL4z",JKijrh1S{鮽{{^׺u{{^׺u{{^׺u{{^׺u{{^׺u{{^׺u{{^׺u{{^׺u{{^׺ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^׽u~{ߺ^٠F, n8  >JFIFHHExifMM*bj(1r2iHHAdobe Photoshop 7.0 CE2007:10:16 09:56:59"(*HHJFIFHH Adobe_CMAdobed            |"?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?zoPW~cl9s?>)պSgRó il8 צ ~cdu-g[Ӫs}bN=3f>+R$ 0- HDZ2Ŀ6LBp#k m;ۿH⎩I]aZ^Q?XjN}~uY/#6V#}o4"y옹nv^֫6}ks/YwU[y=,ΛM=g X8K[ڬͷvӹz?x:ʢYrmlm`|qWZ$r'UuJ:u[_ӎex֓^Y]U l3[~"_{}ՍkX:,SETZv̍rD{lb ½x:3i'_6M7Zw}yѢnoڿ]SY>e!κjFNݿG?k=NN[,k2-SsV϶Wj#g{L3=Zk_Klc]slhkbߪQԮYxtY[m~K(ux6Mf09; m>mֲ?/_SXGSMuEX/ͩ7c[eo5)<P]36ʅYF {ߧ]T"<`xO߮l;[V6=޻5mk9zHlg9ط>2] ,nNKUn9f=VjM~ֺ}5P?lJo*QPRɔ䦏5KrI [{*Z汌<쭣r:P@춶Cu{L7,lV>z:PWY:sFz*7;zӮ][Qz6aȰYuVXoVuz4mopd0~k {bNOiPiޞnЬcioGcA#!MY?ڝ)U/܋>*n0YMx{-ܜ8C/ u68;i. kvz31z~>~C[]YVYK)psmk~6VOܺ⳯1nhwIX=+[[SѬϬͻ+}cb{n~ֱ7oh< L!H=_dX^*{v}c{*)D:%i BJ0VLS&?'Ih=3)Bj%JТ: :&צ?W>>x=?7Z)¥/h;+twt^+ݹ.;@9[>֫E1WPC-+# eVj[^D=C6cxMTFψl@.;i¶+٨бՅKOO\j)iuhֵ=-XYB]ֿc6+=..Ե@?7 ՀBndNh7>RiNYݕ^#C[ޛelD2mlÆ}ɓ4-;VFFASOw5_<}Npf/%Y gSG;OYںSZޡ,o{p~+SY[vVѠk@h7Lx6K]`+t섁PHФ 8` I^=0Nz~3 Og^ǑWK;6n[b[ ;5.&:DN#H&pRI%¯$$*/`p!ATL.I?|BHսQj: C,1;hHο1ͬ2mW4op/wE5KsLӝV4cFߛN=,wzbU dK}S2>w'rN1:nhȹ69NMmZ E5}VA G6Lu)7>'(cX=k6Ʈ'eZf }mTd}/[?K==RF<; 3kD ڴ:1Ŀ *LZ9׷Al)8M>hix{9=?K"T?Di#vb}7~vߢʺ&g̼~Ι,IE9¼W[=,ݛ^읻3{}{glUNEU2s֐zle>ݪ&5{]N.λq0kǻcU~>kI6wOFrU~UoF¯*ImowOR,ۃV6wReuu le_Gҡ\OL}zP|׸*1O{}ZFzok=ϫ]Vl:x}Ť{V3=\9>*gUvWK4T*a:o}fT_z I1|2UѨ:ǴsFc:P}@f2rRX;w՞גNjl4jr25.q=ڸeơBc*ocBE hqEV!v)&PVRI%¤I)$I%)4~) dAK% RBctɪce#Ʃ_Photoshop 3.08BIM%8BIMHH8BIM&?8BIM 8BIM8BIM 8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM8BIM8BIM@@8BIM8BIMYstar-image_180x174nullboundsObjcRct1Top longLeftlongBtomlongRghtlongslicesVlLsObjcslicesliceIDlonggroupIDlongoriginenum ESliceOrigin autoGeneratedTypeenum ESliceTypeImg boundsObjcRct1Top longLeftlongBtomlongRghtlongurlTEXTnullTEXTMsgeTEXTaltTagTEXTcellTextIsHTMLboolcellTextTEXT horzAlignenumESliceHorzAligndefault vertAlignenumESliceVertAligndefault bgColorTypeenumESliceBGColorTypeNone topOutsetlong leftOutsetlong bottomOutsetlong rightOutsetlong8BIM8BIM8BIM |JFIFHH Adobe_CMAdobed            |"?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?zoPW~cl9s?>)պSgRó il8 צ ~cdu-g[Ӫs}bN=3f>+R$ 0- HDZ2Ŀ6LBp#k m;ۿH⎩I]aZ^Q?XjN}~uY/#6V#}o4"y옹nv^֫6}ks/YwU[y=,ΛM=g X8K[ڬͷvӹz?x:ʢYrmlm`|qWZ$r'UuJ:u[_ӎex֓^Y]U l3[~"_{}ՍkX:,SETZv̍rD{lb ½x:3i'_6M7Zw}yѢnoڿ]SY>e!κjFNݿG?k=NN[,k2-SsV϶Wj#g{L3=Zk_Klc]slhkbߪQԮYxtY[m~K(ux6Mf09; m>mֲ?/_SXGSMuEX/ͩ7c[eo5)<P]36ʅYF {ߧ]T"<`xO߮l;[V6=޻5mk9zHlg9ط>2] ,nNKUn9f=VjM~ֺ}5P?lJo*QPRɔ䦏5KrI [{*Z汌<쭣r:P@춶Cu{L7,lV>z:PWY:sFz*7;zӮ][Qz6aȰYuVXoVuz4mopd0~k {bNOiPiޞnЬcioGcA#!MY?ڝ)U/܋>*n0YMx{-ܜ8C/ u68;i. kvz31z~>~C[]YVYK)psmk~6VOܺ⳯1nhwIX=+[[SѬϬͻ+}cb{n~ֱ7oh< L!H=_dX^*{v}c{*)D:%i BJ0VLS&?'Ih=3)Bj%JТ: :&צ?W>>x=?7Z)¥/h;+twt^+ݹ.;@9[>֫E1WPC-+# eVj[^D=C6cxMTFψl@.;i¶+٨бՅKOO\j)iuhֵ=-XYB]ֿc6+=..Ե@?7 ՀBndNh7>RiNYݕ^#C[ޛelD2mlÆ}ɓ4-;VFFASOw5_<}Npf/%Y gSG;OYںSZޡ,o{p~+SY[vVѠk@h7Lx6K]`+t섁PHФ 8` I^=0Nz~3 Og^ǑWK;6n[b[ ;5.&:DN#H&pRI%¯$$*/`p!ATL.I?|BHսQj: C,1;hHο1ͬ2mW4op/wE5KsLӝV4cFߛN=,wzbU dK}S2>w'rN1:nhȹ69NMmZ E5}VA G6Lu)7>'(cX=k6Ʈ'eZf }mTd}/[?K==RF<; 3kD ڴ:1Ŀ *LZ9׷Al)8M>hix{9=?K"T?Di#vb}7~vߢʺ&g̼~Ι,IE9¼W[=,ݛ^읻3{}{glUNEU2s֐zle>ݪ&5{]N.λq0kǻcU~>kI6wOFrU~UoF¯*ImowOR,ۃV6wReuu le_Gҡ\OL}zP|׸*1O{}ZFzok=ϫ]Vl:x}Ť{V3=\9>*gUvWK4T*a:o}fT_z I1|2UѨ:ǴsFc:P}@f2rRX;w՞גNjl4jr25.q=ڸeơBc*ocBE hqEV!v)&PVRI%¤I)$I%)4~) dAK% RBctɪce#Ʃ_8BIM![Adobe PhotoshopAdobe Photoshop 7.0 CE8BIMHhttp://ns.adobe.com/xap/1.0/ adobe:docid:photoshop:88443ddb-7bbc-11dc-8988-b5dcd7535084 !Adobed@ 1 !"2# A3C0B 4% !1"#AQ23CSaqBcRs $br4TDdt%5E   !1AaQq# "2403BCScs$@bDRғd5U 3z8 $RpTa! H'z>ՉWokf=}5N&xl~(`7հĬ^"abQJD@t7/w POֺ6*l$+~Fq4K8t/212x%8 6ukC|vXfĻ+͉hT6v-\`a ^7-x+ Ez)($Nc5E_;96=] \bz'?$<\ZQPÉ œG($?g;d"S6;EvH^,fiS=@O]I`…JFZ})ퟁ__-\:֪AOc~!0"( -$UPy@tG/hud5,V"0~  Jbsj:(JJ DNwg$E{ biI+<aƩ΀oNWsVdD鉝,qdK%F33篣~ 廹+:,7J0NU1:bI%!^CiN qG&pؓv`(4biu/k@ws*R`tBӂ,e!]ff-f2.PU02;٥60>]DI}%E$Dg}v2_/z.fSpWPGFQSx$<p=rE(} y(EN Aկb ׅpE??3n컕v%ߛre=YYiڶ`'?䬢3@H "f|6;xCmp7|l~se\][c2K+JԎ8ӗNsS$BbjvTf?ǥA~״ͻRʶzݳdd=˝)diN ,RCC U`'[ eח|Y97j= MA;ץPhwZ>3NqGJvqy,JT +;>0mGZ`b9CP1a"xF^mݯG,t؈^X|s[)vyЩ-pVqa}7%MwZy) tyR@?62Y1`:Nx`}E"l y%Jh7m$ZP, P+`Yr z*i(8r, 7Di8$@d@\Ԫ e9䔰JH8$rXs0IEHaD?qhSĉvSI܋ƘN.)S}2Q1zMj SwƝBW:S"mI+QX90ʌ)BץyhU&WvE lpڼUJnm9՝ : +EzU)#+˃R nO;j޼gNIV֩oW>%&4< GR1 eWJ V{g۵nCe 2][03 r>'(9AТyE!nS*:XЦb*XIɂ ]F тpq{JG pJ^iG4@T&j @|'RSԠK8 8& I ৫6Zyiڕ{>u #6eOx / ۣB 蔅hzJFI&: O,rM*mHeF pJ N-H=>ۅJM@Y((xx>۶n,EeJJiLY~g?aJr觩t/  (ֶ:J R)k\IYDT[)9"x%#eӤ6M8}][. `aTRP|^Gpg6IHY\C;aVl~.mʼmFfm+aҐyZ;~cW7f4ь FZ**h0rr?ߺX#%&bѯ?Js#t[`GXez SUbPIzڟԼmjUN&誃I5󪊬$$-US͔MZI2 ĵ.\pE]+7+'O ԧhTOx FTuD0̃ 3ltg\ a<ܠ5#d+paρxN ")Ɣ((02D,} 38`)&`yj z{dix^oR*' Pr({,2WGp|O}CypG}JlEɐ0TY 8EèJD&4ȳ2 &>^i@mݠm|/93ED 5"Y)Ӊ1D!(%F`7G4ݿ)JG8)s0`@\ 3 $FhܮY(J=zˀz ӑIF̓E4( bɢ9bK'(s:)voUmR6NkEw& zIUSχ8D]XRK`%T;z oKP:6u[sS\'ׇxB!6ȫ9IkuML7^&V+N.2 uQeU^p3je)G!d%0J4e`%=W{f[]KF"buv}>Yݝמ5G7n}؆mN?iζ횷kU(۟=f! z`FxDD7T[Z~ڵh:Ssmk4.Ymߦ7>'Q{mN2WB.yM57Wji.Bw=՛BWk^ T,2&9q\c`l/蓾KMl)"gT4‡kֽ^:ﱍmƶȱq5AgpړF"©Nc8Hc #?9ӝ6ӿV6uۯH;w*i޻jf?~:ǤcW{CVDr)H'gȉ20dL1e~\I?ZXo{^[ryT)^7۪w;%q;랿# iEq,YF0ZB08HDwiMFnZ9o6njrO/UoHRؾݪF %3LfYjbPDBّ j Km vMQv4w5e]Xn}vsv,YdnMѕ\5$< ,D%#̴n۷Om@KT+s5*/M^vNu nTL ThJ("n''(Rm7wԝ+sPSLfSY|ӐNe2 Q3BC% e9[E[y8qαO٥;7~ZZn/]u ls+}1ȅ21$'(Q?>*F8s aDDJavKMq- M;hSzHm鍳In@6C{ȵyA),'c ̲Ǚ(X(V%}wEN;%ҵL=6K%4PhLi8pHޖe+w=,,9kcLyB9(%b-@NJzƉu1p,E4 M^ BSf{ˤmʟMMUC) 镖_8fbJQGq-h kT SQE( MeͲ!66+ZJH5/\HO/72($;n.к-̝נ7%ׯ+%~۳5+I-֐Ri/ QQI6u\o8nf=)fs,R9>R! b2W!G )ug8xސBaJr!|``J1W :4|S\ɋc@xwiYg/:]Cr i+\ AT(z{]59 F 3қ=8A A):T 8׺5! DN8BKp@HQttq$c֠ء`lm:tXVT+?"}Fyo$הFuahph*bҗb#Cr !sH/c.0P=O'ޒ'bHL*G. 6J斠G;u2\üd%N 긇8&vW|kx+`hsK 2&MlƉW0L$wm%񓃁|)6ҽ Ȫ@ U3' &2`#,cqʝ4|F[Ǧ괦8 n!OsvnAMy3LIE+W7vpdsc'Wb3LQqMf$"{ 8eq5| #U[3Uq\CpnBO #u .&ֿ5j5@ӪVv|#/8Ҩ \}a5;O`'ꑂf+ [VϼDJ4zQvP0ҍC<8w14+(p9t lF>qCm6VCx&:]:ekl.qkA$\7:f˾%o#.%itaq^C<^: ]|ZD|ͷ1Ju'Ra_.rl%-wŗ2o$yրQlExWÖVw,p@f*J ^o&{]kK] 8hgW}lE\t4mq|/搠cmi#h(ƀPe$0B9 uĀCaVrM$4ntdj7+ۑpRR2vD^ FXE{lw  ԕH­!A:?N+>mj)x?j XQױ \j2Ѯ>B~]uU",4?5'(5ڰk"um2K%|N5ӯI;+(hvpoO5mָ>|UxU﷗\hj<I gI^5ζWs/-G`\k˞.pήo/<h ؾʌ05[E5qyϢ,ߝMk;-+fGF*٠XWUq Ypn+xf.m4oOlR%{Uz+et ^ϣ@o+e^-a\j xPѕCSiHZmtGF^5,j45mi6Ms,yUu/e-2%$CVc5qZZ ΅W(O-5ω_jIk>׋Vد1\FeI :v{9,[JXt`UB<77yq,OYXz*T(rW6䣛Mkˬ%2`R q$;* qZIy`n qiv$.8T9G.ȵxv19J0!J?qk׍eGɋYܞ\ƃ3cz`87>8;o=&9UY^9W81?(."@%{5hDa*I@$W6\N`%C DsH wW46m|2z5-j*Wװ=7.sZ /+GGYhqMy1Ue\Oz$"jtnUeCJ3Ƅ5ǭuׄSGUmѡ\.5G\Ze_:^6UӫH׍Bj񫺿kC Oã?ǖE5}߹ż5lB2&T}쒥M^zw@/F !j@;tۇLNԦ[M#3^Y&ougtٚZ1]t# էLJDTo)z*ݎF`UbFUxe<)GP#J1\\HUq1p_j8wPO=A rOU]| sՉK3R6m8`j1+WVh*E"r {C u7js$ѥsH.,ČoDC;)~A~2NE*L8rMуU4HiֻRF5M[G8j5KBr,m[77AuU̲&{qT+C\Տq,BY 6Qt |jxd~21ủ4#>Z]ygѷʒH*53M24Hi P%XQkbqwRVL|.XjyKK5}2hk=b@micPrW.ZS(EEf3Ӵ}u}rًa2 nT:l9bX~TF{jtrPm^V 7#Gy/:t]3Ȯ" ̮'!o3} ⇞"Zs_;NxC3_[ZXc^υAO&\18ڊ(\ ,` {6 zl>Nz26O, uO5{zg^uaDQ@/3 RL\ 1 }6A݄q~ތ_a=wزLj@K7Snnƅ ` ƌ(!=ν9>STi81?+Ȝw%UdI-ZĬ{C!'r$PLFŎlq--euqY/4@s >Q',%[zZyMBЭ8TB+OH)19iiDeTs"W|1!Z:Iʑ!I>땄B*%ENn#]qY,TM5Jf:ÖN.VULٝÁԁ+S "f >]v nAW[hB}fvZsLg?밅tBy.`.bs[fq]!|, d_mq'i[m;=7}6nWSs>_Nki_rQe`@T.&0/-)>јYM抺dQ$S7P2+[RS@8 ,)28D,yFZQ-Rt}{E]PT%/Hi@3܌Hy G$M&$:3&G' J*[hJw0WJڭoQ& . Dm@Ԩ bn|ڙ51FEmIȧ| TPJYwŒ\O m?<8r䊙12Ֆe 3A@T#.:F֟_+ j2#5 a1}Qx8rx J"T84MJQ|Toot.\tAYM][RSNdn0@n`EaT7DD(3Cݪ'(,&7Z`a#: >K^"۾!h3t.eCj} ˪ammODtZfN/K$JP(eJ-:rbi(2ba}!E|n7>Mv2jc@UUW2c{YjzQc ^Կ+)'6I0`7 {sP('AnPaЕ=љ*jʙs*zp B/-0b̨)a{Vṗ˷LȬiյy{:S --+ĥɭl0B(gJԴI豊Hjy]NRց-,`3L-+8ڲq/RE|L^{~bˆ9*1Č`A2AO< žnr<춄{hL:#Jm JiX2B3HCD!F.XgBf:SiU=!Sm2Țij91`J 1j\ͺZp*J†R!p)1)!Dށ)INQ)(X Cx.˜ K{-X w80` ~&69/!o=q>y/iy~i\L,7zAqEپTm0BU"T )C:6I@`pNp,Q̿SCVHƩ$9M,EVQ%61]0%$!(1va}T9e^3BZsm-6mDD(AOki?ZB@`22qOĆ`?Uy>bFUe '@i+QSJԐ kpn4]ouXB)G8՘d5ztX;2ﶋ+iCՈXo?Mh=Xca!j-(͝ڣ ᗦ-Zb0b1tk,3]1y`7L݃ZiX`k]0G twB\?-zB{IYL6֚_j'4 `!Dn .#  Z勖B%*%DgSͬUST#)aPE ƗTcnMqu { [I8́G›*fh QƱ`-9c+Q,y_x:̗bLA..,M.[CTӭJ!1pTxU9w$PT2$n&Z2 幁ٍZ`0ٝ nN L59c.׀#0N=k#!+e(bLIj0-at  gS狳"S,xkҀƪ0hL1D$BJPe<𬣕 d#Y=@T D*peI-Pva1( Ү4 ( (0WlB۾𯰦.KÚ:<;y#23LU{7瑙L[&]T|@^3S^K4Ɯw,${E/+i.BC`S^ݦ'ueї G <,f eo. ,r_XA&}6ڸ!X6ÛfIiF?;um6C:Ĩ.NiE&^ްӋh f t70sk:'U:LV4h [CtBڛ;J!2tTna9U.jjqR41 9fPn_]f;N}fEwHP \Y<}P-+JĔH$bat!g欏Κ,jQc]+P*omqXI^L403Bq]6klnxf˚}h `|FQ(vfS( M(Qzjj>rף̫]V*pw'8ruX2#O4(F ݫiʹtQF&oXY5)g&D(0x[d3_!wfk#d>P,(0,gXX\uEl3 3niOrR7j.ڋ( NtCgG 99qN ,'6%Q!!IV0"&F=7->а|ۣ)CWunxf/tE~~2iBd6|ڵe B<^NM6thJ-auřꉀAՖ_- O>D@,m߯lI@'ab ak t?uc'sy1 !a3fk N:P@eT3#7{#%rɌL'Pδ||\FE?=Hiwn_$StQX'k059 z؅Urc#Sq6̔Bp$:(NG(`N:M6cs1:*?ͼZ´@Y/'ل%i3=MJSjU`= 4K6a.v)2tۓŰD!bCEwvmO0!4#i;_-(AgsX!cGifI M^tqzabǣ&˒„ BT^c|r7HM`SҤ S'o;MJpNSM7;1N-4?%.7/s`X™4`dA$ .x;BPTwE`bBIFGDE#GѰDpOu{8*̭$Z 3!= 1UL7eiDʖA@p 0Sm>&\.b22fs`.?c(3!xujxEx>niDdg~O҄W3dQܖ S 0;Qr?3*p].hx2[H%C7Fe,b6PYlJ(whl#֕NY+4oFQ]Z_jS_(Y;-KӨ$BKj2˺p~O%=]a_/.\?&TYġmkJaM͠6T*f@Qʨ[,&(7{k=r~,2E+zP?6,Y~eպ$?Nxkw?=;XW_'5dC2_4{]V0 AM2݉&~amHac3b. pYZ5~ q'/k#ܫr%7/ˬ͡B/djk5i.~f>kX"N" G˧hDBņkMZ^k`[+X I}¹m^u+g(Y?!*FB8䞬ʱd#jL :5`1B`d>tiowwaI8mH0 y1;CAqh L  _6K"A~%9Qa@0GWES*sP+ IW*F{_ 0妘bfQC5$ٽUB0)%bDí5+n?)TC@OFۂoڜOtRXcLY.P"DP&]h2ylgO버dF 7~O5{*Ok$~b3I~@tG:3.յ)qqNc> 05hY` a}D];պZY,aQb_YuAY _MvD Wa{B/Wa@caL) Iy-4 [W?WB2aFGG׊#}m7Fvˉ~~[m5݀p̔#4|#cXn 3ylc=X3<:'*Ⱥjvm%PF)PZ; T8#v'3mnTc(_1:MzJRSMӵQXrɪ_inW~W`D:" =ߢo6߯\5zcaFD?ԇꍴm]wza^Cz{t(!bӆ^'-H-(1KN+Z5 f@:756XCRae0 ^QGbT F@ asY*rLynb RWTp:š,e?* `Q(p-:|JRV2YȬ/.؁|t!dAyΞ 9}QP^je2W.NY(߅ CNXb| &vgL>] %+9Slc,dJԵMb5+ |ye7QQRjZ1 L$܍ƔA*6-φdtbΆ٥6ت_fFL^PI}G#R$3au/<-'bN圓-ݵfafk7}0אEppBj{(wcE+,^wTr P{EFK{C9v x%]9Ly<( Kc!n`L,a, ݒ>yw pἵO,}쇧p:~-L&J˒TeWԛr m >ק'JA 4dD<'ƾX@me_Vl-7)w*EuWƷҌ&LQP:c{(=5n9EDѵ#+PPC V9קy9گB(R)R$d- G9!<7u53mzꉸjW1rfo\s+i*1(&rH!6$,kV',f:+'knR仿&+ER \M4+FYp Q'VUtRdKS/ QSiޗ.PkR$S͌^ mGL! waA*!JJ{ו/vTq8,Pn!ʝq.QwzeP'V±%\`]E~haҌ!W-ia %֨ o$ni6%a M^h{`{?Xs](Pw/co ӣE{F!2hvǒ ^naF[;?5րm!yX7O]ZQFa,]-v·}1wvh", /rZ (}GaBaK!%yahB_k,"7]BLe3vaB=f^^A4AD8b{]rExifMM*bj(1r2i,,Adobe Photoshop CS Macintosh2006:10:20 14:31:48&(.HHJFIFHH Adobe_CMAdobed            u" ?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?DI%)$I:~Xq'l}9&FAhS5\`y^졹"꫱-םޜ?s~zneniG`E_U#b\-rE`p$N)^YXe8xxl:N>3w$1{1NK7nXz~ѹĻo hpsj!mg}8%WJvI$)$IJI$RI$铤U9IPw{֒ʛ˝D 4Xm=Xֹ4nt)Ec4;j=eRq1jl:C~l*:N'4Suۉִ} ڦO.ke8meu6)e7mu41L2'rf5NRI4f>@h?p*[˭." hkNd}\n7֯߀=zNOQ3[Xzs[% hPrQ}[]m ckZ4 hH=A/;=s1,mb{=O]S+t`9mad;[=?ok(wBQ|i)Wxk\>Ira~;d4_;m+j{qŰr) Xʷ Q)2!/%_ N^fŔ%1׵cuT:9VbL- =#R& k<_+Фa GG_EHcmw5D}o1YqZrhHMwl7ӵ;d.g9$>aڧBȧ&dcYMcۨ ?U]K#:~[iދ~^g6@$S)?\MlTXd2ֶk=[Q[qh61@qM,RDI5JAͷþ=:Ksq~#X܊Qsy,7F*ŝVT2m}5O.ywꔷv%fzv|Uzg֞rN.O}u$7?9J9N0#& i5 9O& r388%Y=+u o[\"oc~affÆ׿ou~K~ɰdZƷs}'lܹsfŇecc'=D휛 q^T:KnikVr4ٖ{]N[It5h>7{~V%ѱ_T r:FWa>7V7Un.paߑclv {;s%f~?\ͩc+7鮆mwv_.:=\?Tv:QNX{ˋJIGΖΥk"nwwoUYhʩX$)Fq~`Ao+-snN ,Ͳ{6.o\'ưW " M~o÷U[WnjֺGHKƫ))Fpr朁hFe7o{YpönN`v]n&c+sZ\jJgՎ]u6^ [E#Wc^ HM4ꦍ\3zNfE50C1"kM?U֝Ymc[hŦnٗOEf5T1jw} ?tFQch/mYUv {q{M;^5TvO,FK(FgKqS'c]Fn>#riTE?*܇߈wDo_{3(ɲ*驶ܭH[8U01)8{YD7Ӻ7-m]=T}[۟eͮ) ֻe 8 .]cޜN=axVفwڽ;3u^K?M KO=s=au ( ԵuͮM~?[g3=g&݋CmnF\C-mczΥQf?oMdW_Ow׎S]~9׈;"[jح5zY0Q Gz&TZ\T=cm./u-Y[}Ms4眫ocձ9ҮG)MW[fʽvChN=M@MezW͟AV ID]5pT #'r}ZL[j%~f؉:O[I|#5kXvnQ.Wnm6{>=]kV+9sZIƿ]nTcDMowe u!㗹 ɿ~b~AK䍮n{}PݕӝOɟC 6\!tZ.|emN kmƭ๖z?I*Lն[f +,>?;~*b%|gu9?Oa0Xuέ=[c\\|{(p99`xiN/Om]\;sU9{\&2Gt+{:YĸS c:0us=R6<#(چXF\X!я ?}' c˜~eudl̋?Q3cevV4 GK7ClZȘI&ζT" JqV6YeF >ՍԪ#-dK??}/:jyo-UCV{2mb$ $Iu$0[1*q۲KGK2?#UpnVG/UWsU\x#P.9wCRo}[I~ߡmMoGvZ^If2X\I#ܩ_@uW]lSvki nnDG/ }/ѳ]Zմ=ʐуe]6^AhiyyooGL?T$$I)מeAvOmtsr6 /`=6enw n#['!ŹZ}\Nۚ}]!0'TmXFǦ>$Y >)HtSR%–7w5G+!WI_[$9w[Ul/1.km7ܥGMϵUm-e97Mlqok}7 oi1uNmdޕfGѐkVs^̻˘i}w˜]IDc[D&tMԚ+y$?\e$I'R$I)I$JRtSMu[hyA /zU1S*mmVeYso ǿ=r9x ϴnS+eug"?_hvK=;#'eTXXĈ$EP@>U[f ;nI[1] h}UcG\gH*s`Mw5ՑsCjklE.j~= k_U q]Y4l~GMgbyᯤ{;?Hpc~ iܰ eb믧u{KciccD}-mcv/;8c[v3$ kuu5 c+̏V+@bRG\[s.fV´U?'LVkBsu[sU[r?Ig?oC:\xU e6\Ҩ~KEw=^X G*I q+;-X׸c]lsWl}Ok>U]F&dNʿL,8y%ynh3{7]q*6QVX囘׸RimG+o[oeN+ n,5s7OF_R?w3\*ބ3ʿq99,5sTPv3G7lW;-ʷQcqʫۑG0~;moYo=}cӲLctycvѷ#׏e_иg6<7WU7a]ۍחZk+f14NgO moPDZcsg᝿Nl,r+]/UokgDU ?.gJqoNF337+kn,ݻk/w$ٕmn>Umegۃ{os*Nߒ͞OO|xUoegDU)?.gJj벷QMl8R꽶6ޣf#VETeƻ^,{1~ФVZqwd+ms?KZwU9W-Ypov%WT1ֿ \7 0ų=w}Żk?جqbo]oQԤ*&Db͟CqnC}wC7U ŒVq|ȏu_zkĒH>gU ŒKW`~[V>ݳ|??7~_[fWݷs>ӻQ?FtI3')= Photoshop 3.08BIM8BIM%F &Vڰw8BIM com.apple.print.PageFormat.PMHorizontalRes com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMHorizontalRes 72 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2003-10-31T09:38:55Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMOrientation com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMOrientation 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2003-10-31T09:38:55Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMScaling com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMScaling 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2003-10-31T09:38:55Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMVerticalRes com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMVerticalRes 72 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2003-10-31T09:38:55Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMVerticalScaling com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMVerticalScaling 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2003-10-31T09:38:55Z com.apple.print.ticket.stateFlag 0 com.apple.print.subTicket.paper_info_ticket com.apple.print.PageFormat.PMAdjustedPageRect com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMAdjustedPageRect 0.0 0.0 783 559 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-20T11:18:28Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMAdjustedPaperRect com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMAdjustedPaperRect -18 -18 824 577 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2006-10-20T11:18:28Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.PMPaperName com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMPaperName iso-a4 com.apple.print.ticket.client com.apple.print.pm.PostScript com.apple.print.ticket.modDate 2000-07-28T22:57:04Z com.apple.print.ticket.stateFlag 1 com.apple.print.PaperInfo.PMUnadjustedPageRect com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMUnadjustedPageRect 0.0 0.0 783 559 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2003-10-31T09:38:55Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.PMUnadjustedPaperRect com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMUnadjustedPaperRect -18 -18 824 577 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2003-10-31T09:38:55Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.ppd.PMPaperName com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.ppd.PMPaperName A4 com.apple.print.ticket.client com.apple.print.pm.PostScript com.apple.print.ticket.modDate 2000-07-28T22:57:04Z com.apple.print.ticket.stateFlag 1 com.apple.print.ticket.APIVersion 00.20 com.apple.print.ticket.privateLock com.apple.print.ticket.type com.apple.print.PaperInfoTicket com.apple.print.ticket.APIVersion 00.20 com.apple.print.ticket.privateLock com.apple.print.ticket.type com.apple.print.PageFormatTicket 8BIMxHH/8Ag{HH(dh 8BIM,,8BIM&?8BIM 8BIM8BIM 8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM8BIM8BIM[@@ a|@+KJrMZ\Q8BIM8BIMYEURO 500 WINNER 06nullboundsObjcRct1Top longLeftlongBtomlongRghtlongslicesVlLsObjcslicesliceIDlonggroupIDlongoriginenum ESliceOrigin autoGeneratedTypeenum ESliceTypeImg boundsObjcRct1Top longLeftlongBtomlongRghtlongurlTEXTnullTEXTMsgeTEXTaltTagTEXTcellTextIsHTMLboolcellTextTEXT horzAlignenumESliceHorzAligndefault vertAlignenumESliceVertAligndefault bgColorTypeenumESliceBGColorTypeNone topOutsetlong leftOutsetlong bottomOutsetlong rightOutsetlong8BIM( ?8BIMM8BIM u`JFIFHH Adobe_CMAdobed            u" ?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?DI%)$I:~Xq'l}9&FAhS5\`y^졹"꫱-םޜ?s~zneniG`E_U#b\-rE`p$N)^YXe8xxl:N>3w$1{1NK7nXz~ѹĻo hpsj!mg}8%WJvI$)$IJI$RI$铤U9IPw{֒ʛ˝D 4Xm=Xֹ4nt)Ec4;j=eRq1jl:C~l*:N'4Suۉִ} ڦO.ke8meu6)e7mu41L2'rf5NRI4f>@h?p*[˭." hkNd}\n7֯߀=zNOQ3[Xzs[% hPrQ}[]m ckZ4 hH=A/;=s1,mb{=O]S+t`9mad;[=?ok(wBQ|i)Wxk\>Ira~;d4_;m+j{qŰr) Xʷ Q)2!/%_ N^fŔ%1׵cuT:9VbL- =#R& k<_+Фa GG_EHcmw5D}o1YqZrhHMwl7ӵ;d.g9$>aڧBȧ&dcYMcۨ ?U]K#:~[iދ~^g6@$S)?\MlTXd2ֶk=[Q[qh61@qM,RDI5JAͷþ=:Ksq~#X܊Qsy,7F*ŝVT2m}5O.ywꔷv%fzv|Uzg֞rN.O}u$7?9J9N0#& i5 9O& r388%Y=+u o[\"oc~affÆ׿ou~K~ɰdZƷs}'lܹsfŇecc'=D휛 q^T:KnikVr4ٖ{]N[It5h>7{~V%ѱ_T r:FWa>7V7Un.paߑclv {;s%f~?\ͩc+7鮆mwv_.:=\?Tv:QNX{ˋJIGΖΥk"nwwoUYhʩX$)Fq~`Ao+-snN ,Ͳ{6.o\'ưW " M~o÷U[WnjֺGHKƫ))Fpr朁hFe7o{YpönN`v]n&c+sZ\jJgՎ]u6^ [E#Wc^ HM4ꦍ\3zNfE50C1"kM?U֝Ymc[hŦnٗOEf5T1jw} ?tFQch/mYUv {q{M;^5TvO,FK(FgKqS'c]Fn>#riTE?*܇߈wDo_{3(ɲ*驶ܭH[8U01)8{YD7Ӻ7-m]=T}[۟eͮ) ֻe 8 .]cޜN=axVفwڽ;3u^K?M KO=s=au ( ԵuͮM~?[g3=g&݋CmnF\C-mczΥQf?oMdW_Ow׎S]~9׈;"[jح5zY0Q Gz&TZ\T=cm./u-Y[}Ms4眫ocձ9ҮG)MW[fʽvChN=M@MezW͟AV ID]5pT #'r}ZL[j%~f؉:O[I|#5kXvnQ.Wnm6{>=]kV+9sZIƿ]nTcDMowe u!㗹 ɿ~b~AK䍮n{}PݕӝOɟC 6\!tZ.|emN kmƭ๖z?I*Lն[f +,>?;~*b%|gu9?Oa0Xuέ=[c\\|{(p99`xiN/Om]\;sU9{\&2Gt+{:YĸS c:0us=R6<#(چXF\X!я ?}' c˜~eudl̋?Q3cevV4 GK7ClZȘI&ζT" JqV6YeF >ՍԪ#-dK??}/:jyo-UCV{2mb$ $Iu$0[1*q۲KGK2?#UpnVG/UWsU\x#P.9wCRo}[I~ߡmMoGvZ^If2X\I#ܩ_@uW]lSvki nnDG/ }/ѳ]Zմ=ʐуe]6^AhiyyooGL?T$$I)מeAvOmtsr6 /`=6enw n#['!ŹZ}\Nۚ}]!0'TmXFǦ>$Y >)HtSR%–7w5G+!WI_[$9w[Ul/1.km7ܥGMϵUm-e97Mlqok}7 oi1uNmdޕfGѐkVs^̻˘i}w˜]IDc[D&tMԚ+y$?\e$I'R$I)I$JRtSMu[hyA /zU1S*mmVeYso ǿ=r9x ϴnS+eug"?_hvK=;#'eTXXĈ$EP@>U[f ;nI[1] h}UcG\gH*s`Mw5ՑsCjklE.j~= k_U q]Y4l~GMgbyᯤ{;?Hpc~ iܰ eb믧u{KciccD}-mcv/;8c[v3$ kuu5 c+̏V+@bRG\[s.fV´U?'LVkBsu[sU[r?Ig?oC:\xU e6\Ҩ~KEw=^X G*I q+;-X׸c]lsWl}Ok>U]F&dNʿL,8y%ynh3{7]q*6QVX囘׸RimG+o[oeN+ n,5s7OF_R?w3\*ބ3ʿq99,5sTPv3G7lW;-ʷQcqʫۑG0~;moYo=}cӲLctycvѷ#׏e_иg6<7WU7a]ۍחZk+f14NgO moPDZcsg᝿Nl,r+]/UokgDU ?.gJqoNF337+kn,ݻk/w$ٕmn>Umegۃ{os*Nߒ͞OO|xUoegDU)?.gJj벷QMl8R꽶6ޣf#VETeƻ^,{1~ФVZqwd+ms?KZwU9W-Ypov%WT1ֿ \7 0ų=w}Żk?جqbo]oQԤ*&Db͟CqnC}wC7U ŒVq|ȏu_zkĒH>gU ŒKW`~[V>ݳ|??7~_[fWݷs>ӻQ?FtI3')8BIM!SAdobe PhotoshopAdobe Photoshop CS8BIMAhttp://ns.adobe.com/xap/1.0/ 4294967295 944 692 300/1 300/1 2 1 2006-10-20T14:31:48+02:00 2006-10-20T14:31:48+02:00 2006-10-20T14:31:48+02:00 Adobe Photoshop CS Macintosh uuid:b8d9b2f4-6023-11db-bf6b-f4193988e0ed adobe:docid:photoshop:b7b8bda5-6019-11db-bf6b-f4193988e0ed adobe:docid:photoshop:17ca1052-6024-11db-bf6b-f4193988e0ed image/jpeg }ICC_PROFILElADBEprtrCMYKLab acspAPPLADBE-ADBE descncprtl+wtptA2B0A2B2A2B1B2A0E8B2A1~p8B2A2$8gamtdescEuroscale Coated v2textCopyright 2000 Adobe Systems, Inc.XYZ ӂ@fmft2 )h@ v b K5!~rh^UNHC ?!<":#9$9%9&:';(=)@*E+J,P-W._/h0q1|23456789:;<=?@AB'C3D@ENF\GjHyIJKLMNOPQSTU.V?WPXbYtZ[\]^_`acd e3fFgYhmijklmnopr st1uDvVwhxzyz{|}~  +5>GPW\_abcba_\XSMF>6," סĢr\E-̬fM3̵jS<'ؿ›Îăypic]VRNLKLNQV\dny׆ؔ٣ڴ3K]p1Uy9a P zQ+ ~ S ( c>hF%sY? &! !"#$%&'u(c)R*C+2,- -./01234567s8f9[:Q;G1?,@(A%B#C#DEFGHIJKL M%N,O4P>QFRLSST\UeVpW|XYZ[\]^`ab$c7dJe_fughijkm n)oEp^qwrstuwxy?@yAuBqCnDlEkFkGlHnIqJuKzL~MNOPQRSTUVWYZ["\3]E^Y_m`abcdegh,iFjak|lmnoqr.sNtnuvwxz{0|P}p~Ё.MlƊ0H`vȖۗ )6BMV_fmrvz|~~~}{xuqlf`YRJA90&߿°åěőƇ~vnga[WSQOOPSW]dknsyہ܋ݖޢ߰>d ;l F%U~l5`f* J  zHR&W0 zX7  !"#$%e&J'0(()*+,-.{/g0T1B203 4556789:;<=>?@xApBiCcD]EXFRGMHIIEJAK>LY@ZD[G\L]P^V_[`aagblcsdzefghijklmnopr st(u8vJw\xoyz{|}~ %>Wrƈ"Bcɑ4Y~ș:aա#Jq 0Vz%Ee¹7Rn¼5Lcy̏͡β%5FWhy܊ݜޭ߾ (3]'Ko1==. L]wv~pP#~ۀ}{ց4}_*}?QEM-|| |,}ؐx~xF$P\O?(|}΅v{{|*}~v~k[M~.>;u|\{!{E{|}~u}ݚ5Z~ =|~{Ҍ^zĿ z{R~|C} s}o2Y'}U<~k {znz,{"|݌|ְr} |Xq}d<~ z{Tzu zn1zɽ{|XrE|貳X })e樞+&er{TdnKՎ32`D`ݼtΥm싾"ybЈK J<1D'nʼnM##ts>Jx9ar]JVךA1R‹ގĹ_r5@"eJw_)a(IՇ}N1!2o$̱ԸnJأ*#:6ѴIgk1 эezĴalz×fzzu z^zG>{,ۑ}| |+uK:vSs’́].FC,MS }RFGOEƓ^rY戬\ZEe,M ӎ5:* +-RpБ[ PDrKW, ]4"3=vonYǕC+Ǎ8lNjTJ)VIʃ'ny;6YUC'<+R˜7L2+fmX BŌ؞+߼-ɗVJFё;mX%ժB2+.5Eϓ81lLWҍByn^+Pkiz yԠ y~%pyiz Ukz>,{%җ}F (}τJEV}RqhT*K>L% Ӕˀ`ߣЌY{ܛtgۘˇSH]Z=I& [ƒ9?rBЍtzfRM=$&YF FƟByJ=ed\QTy].25vbc}*O稖; &wXu ʌ؉R d ʈbßvaBc*WOR;ёۥ,& 1MgyLye ypqyq_(yK~;z}6|R|}2`b.}^oqFq^s>J6rNK0_5'\p\] Jp6A\_tAΣaЪrhqoUʏx\ʟ9BIΜ f6> Q؊|7BéـtnjI[ߞwI(g54Z | 'LLcFhmџ[DH5nt! ՆРv;2~,hmlIZ̝H[c5~8!M ސއY ߏػ]~^l.ZwgVH85!" }ğ2RŻ}Կ*l#Z2=8H5U!Ė 򏋈Pygay%wjxf_xTygBEz.||n}Y[Bw$o)ʄ߸0te c3RUcARg/PAj r\Bϭsc:q REѢAĞ>/ot=듐շ$sIJb֩Qg@bw/qғ Ȇ~iqǙ4c1s-bдQԤ1@'L/?a 3ՊLƤy9{!Yxk[4x[%xJ@yf9=dz&S{WU{l~qzk5[&J9'b?=ـjzYjÇs[Je9ޫ"( Zԅ}mßJy8j2Zt JF;9݌`(BVSҙ 5yhjE&9ZwfJXR:Б) -oT;—y Ki総^Z5J@: @)m bb̈́Q*;xhiY}J4,:-O)ˣ(J*iPȄ湼xp?i\Yױ J,J:Tˠ*&{Ǟk q6x?i1NY0J3:Cf*6c|fy1n]cx_lƊx\Px@~My0. {_{ 9{N|⁘nwa_PA"i>1΀΀ \|ϐnɝ?_àP𽍆A1׆!8:,xwQ|~cnȁ;`sQ:AF2/">JYG|aͩnǜx`zgQ:,B% 2ϑ1# `ę|88nd`QKPMBc"3BI#vݥь#_|̃~nAO6_ZQRBbu3ۚ$Nޕ7֤Nj {n!ڱ\_⿃QU Bͣ3<7$˨o,ф{׿*nł_ӿ8Q[Bβc{4ˠ% uHQ6{ay{yiu|Gy{}Gy.~2z u7~z%Z~z+wv|u[sάv2wbx ymzJS{{;8{3JvQu Řu徙w^x_y`UlDyRz7{:Lmucwt>u_HvDx#ykyRazoZ7gzដuymtʴu"CvЧaw\xkkyrR z>7CzuJMw҃wxx}~ԨB~ݳcQzKqicYBKA1И{ѷ~ct ~Vg~Y:y{.bJt1p={a~_ۼ~G&~ꏂ~xb ~곁JF10'zZv.nvЋv &wnxӊvwa뉜x0Iwy.Iz ysׁx(Ԁأ9Ҍ/.'& i& PQ|Lh$2S>&f Hمq僚{E6g>R{=&9 ɇֳU(/C/ʐ 0} $cm3X]\4 wfRxTB0XG7qya0wseOT/Bh00MƓ%𺄆ꣀvwFe0SƙBC]=0VE Xꕉżi]udȜسSyB*0Fn2 2̆7msbt"ort~_EtNNuĂe'z! C~ʆK%A'Yt ~C`~ |npgρS-6>ş-'J }a*vL΅;(Y{"g0VRI =Ɂ'4! W|X0oo3p}qz rofsu"w8pLw;~z1e4iz Pzg:{"}]|${ ].h6wMcAOJ:ŁO"Oʀ'H~}@ɍweB|uNbI,M9!"*k3OS՚^WNt`Ld8o"P@u֤ѡъs_Lj7A!eeăinܗlɊr_&K7! VP{J6 &q;dqʼn8)^2K37_M"w Ɂ膝ƌ1\T4 q4]Jˇo7%" jעY_nLo֘cpnȖq\(rH“s4uєvlwyyIՖyNmy5[DyLG3z3E{W䒡{!^{05Sa~zlfЀY͒ )F2ǀŀYh~=iW}j X7?E*2NP1҉Ɓ gpꕤ{"iǒ"W;iDÏ\F1։IԈm;80zY6h둇V֖/DÓ1LɌS8zh*YVdCȎI1\)ދRohg>gy_g U/C1뚉G%؅N̖J艧:xŒff򐍲hUެaC,0ٌݓ;88n#otpuc>gqIQ؜r;?s,Ju~.uzx8Tx_sZ}xdbxfQx>y+{%8~z{+rdE+aP/d>[C+(v~{q=_`qOHo=݆k+T΅8YՍ'xa;>pSV_NW=j+$&#N:Ho/^ؙ]MՖό~ n\4]L$<9]C+a}95} mߚ]JOL(< *HgڱSnv˭ogͪ8oXpG֣q6s$$ub @ua9{믞wPvG whgcwqW9wGuTx6ly$Xz#zdH};Gu|f˧M~W~FC6X$8r@1~@/tfOVh!Fu6Ņ$Ӝ$@3]3Ёsot Ee`UӢE 5ԜƋ$ΊVox囏sj`TdϤLUYkTEZU5%#ߗ̉qHS/brܢdUWTۜE^5?%`ÒyAS>r}ycvTpPDPE5jɛ%0䋒OC)r3BcT:/rDʝ5R%՗G]wmi7n\[߳o$M/p%=q-^stuv}vvaivv`[в9vM6!w>xM.C>yzC ޥfz~v<~iW~G[}M~8> ~.i䤘 x~u[h݆@[DLƫgd=d.2 ˠu)/hZ󮦍{Ll=Ǧ.ӣ\ ,tDh8AKZ镀LM=֑.ݢkٜu?~tJgᱳ5ZVRL=*/ L %sgBZڥjK=/8D tÓdV ˍsSg~MYK.=i@/ٜs qO>q8L*iTm]NsmPnfBDo4 q{$ҳsAWsr+v+s~i^up]pu_PcuBѷv4̳x!%yO[yziī}]}(P})C<}5k~&Q0 ~~iH]lPҹZCn]5˯'Zqq ix2l]MP߸/FC5(ljcdP eiNZL]lfPٷDC)@68(w + vA?Xi$G]cP˶*Ce6br(֨Ϥr VW)Wvh0 ]F5P[C͟06)֗O ߈hտұ]-խP(C^6)HQ l3hNrqlwsmڬkuo=wp~xqfxrMz s1z`t $vzr oyqy?sbyQuy|v;ydw8y}L xy0vxz8 tvt*mFoBqRss_ez|tRcùVJxwN/tw'~ sozϢl JBn:ApCBQr &xsc aUtqI!v9n.uل rrC~Wk c/m3MoF4q vrb_sHuW-t qK"WjJXlw)nRpGNuq^sG.t.-s܎ pɬiPkmoWtq]rxFt-.s! /o݇RigÀ}k{mo5 spk]]r F-s,r Wo]Ni;рskRϞmEnrp;n\qEsA,r( tn{=kNp{l|n8}ot}p]~UqE]s+t}1rĕxw3ywAzw{x.r|xK[|x`DM}y*}y{_w'vͯKw܂&#y jzp:zZ{gB|L)Q|Z~y{^uD;vwŠЃxnhym$XzPA{r(z Wx~t;5u=vɔ?:whlxtW:yo]@z(5yۈ wls|tСv vvkwVx@yՑ'x鍲 DvOvr%tDcuvivaCjwTUox*C?vy7'x$ uՆEDr]sLu ~uiv5Tw?!x'}w uFYar|sjtɿ|}ui:v]T[wt>xm']w"g t܇zфKjIDŽ?kݑRmf}Gni pTs'q(>r$Z{tKsu!v#2Sv|Smvg[wRׂw{}ɘ@k 7XK֓mEK2x΋ЀmrH@|6+j6WEJD߄g1˄@_`OW %Q{߄̬ig7VݣD}i1  4 ~󄜛{{*h~V\]De1cg %~w՗ai!jx )l;fmU fnBmpE.vNr`_sw#5sSwt w%@teɐtSԏu^AFtv-x{rx y}3$}uѐ|dh{|&Ry|/@C*|,"}ЎC|P|KᄈtTbeQFk2?EA,oՂ hE(ʑOS s*Ǎ a||Oi>Z$, uӅBaT\WYr? `팿Oi͑=g+ʍ`L.bn͢qay`20jN݋@?=nΖ + ꈎ|l1Əڰhip K_ƤNYڠx=%`V+}Ȏ<*&pƲ^M㊗a<ϊp+J'+EW:̉ghzjOkk[xlKnN9p%&@r0@/@ܖ؋B^j1vBϕ/ 3L4?}u5vi8p[JMT>RT/Z ^&(҈uMiGS[LӛF@>!9/id Q^摇H8mgaChT\j'F k7mx'0oWpr|lp[apSaqF r7tt)([ujSvk@%w ~Tlx`dxSxE`y7z({m{͞H|/ l'`D SXbE7;>( ^4Q ݀k_SPeEW7M {)Ҟ )jՒ_|%RxRE 7D)#g ^naJj/T_"{TRhʘ6DV7=X)Oe; Dij<^٪R+ADŜ77)留pȏ 튧MiM^R.Dc 6O)^iwj? ԕej`dfThgH2"i;/Mj-alͱn#os~9`*o Tͼ>oHp;³q.is u)uxE'e`wJTߺOwdHw*_ڻÇTnEI <†/"l/:>`_ÐT϶mzIyaѡŋK S*|9T_CZ4TH䰊<3F0=FX#8[ ÙW-r_TqHհ<0T4# I "߁$nn fNognqismkvtm_muoG|w-pN,v}qtPnǃjram,sEoIs߉q tsrfuE]MsuEufvD*tMvzs]s`hv~ksj~m(}o}cqp|[rr,|hCs|)rO|'rwAf+!i-֚kx~maoo{YpЃtBrd(pC\q{e: gߓj37lndsފnOuvW:v"tOTuN`DmF oTpwq#cmrNt9u"jsO=tۭlĜnDo4vjp瞸b{r3bN@sؗ9Ht":rNsݬl Bm҈o&RumpOaqMsM8t"qbskÇmfLnƸto\aq>M,r8s!ps.!d4fTԀ-hbuPjJa}kMp4mv7.oZ#pfq|oW;}Fp}K}qwsi~rD_~rKus6~du<u~suzczII{&zr{zeq|;z ^|yJ1}zS5M~{0}z|yvxay)z?!oz\~{s-H|"4Y}LD{{`|wnxRyn;y[zSG{3| z\h@z8wvc(w^x3mxZynFz2{ ay yGuɥvk~}wJ*kwܜYލ3,bԊ*'}́3փ5=sNua PB>u!,o~ |~~`rz~a~kO~?>3+LT}0'|XΐO~m~Q{q~1c`y~7O~Y=.+~՘|z{߃ cB~ÐecoEgX^ڎiM֍j;&l(nPo_vvupmZ}Lnn;Bo]hpVLqJ:ȌZr'tmtb y:^w|!mwnl݋~w\JwKDx9y9'%zWyN{]ƀzk\sZ‰r~IF~8‰vn&SWȈ~ }hyĈj3YXH27ՈM&qX߂nljxגPiVXŇpHRc7:Z&&ωc-awNhzMXCG6&-bāxv쇐gņZWh7oG 6%0'@[K)v\2g/cbVمߧFĢ6_%-C4~bqdcHfSKhDhj=3FNlf Ǖn bo#x}DlpݗXmbnS*=oC2p2^r dt Y5t2{|c>uova|vGRvB?w1ܑx Dy 4|y$a|{(~n~~Z`B~PR}AS~h1EA~ 4~ 4}~ym}_ZtP@@c+0 ,D Ofy4l^Oc]m? 02r FUƄԀax%ߛQlK]ӗNŎ+?~풽00M P1ɉyEwq[kgt]eGKNG!?$dE/ ^:ԃ:=v)jZ\樕Mݍǣ>эW/, :Q8J>qH bYd?dFWfIdg:~i*lmocOzpRkvdolW!mH뜢n:rp]*hrN seƗt}A|ont2ctVuu H>u9w*6xa{xyj~7n|bŝ|Ud|G{}9Q})P~4ؖ} }msbpTDFup8x%6)͕-Ȃ ␰ OlѝҎaaTc\Fo89.)։ER $Āl0p`КS嘛(F ˓&8Y)܎ o |<\>kqh`'S GE<%7)/(6 ̀k* `S2EP٠7oYf){+ ?(iCd aXcILwe>רf0fi!ԥkw{l]p|Ucmsj5XM*k>K1ld>ҥm1o"LqHrc ]u4}bUrWة5sKKs>t1 v"w2wy:b\zWlzKG{X>DK|0V|"螴}]}ϖ5}{kaǩZBV\J𣃃>50 #ZܔIa4T/VZJ=ɠ+0<#5ƈ+ϒ(`V19JL=708#xVØK;`SҞU眻J H=l0>#ޑX-U PL?+_YdUrI栦H=.0uk#DYU* ҆q^}V`MKa@Irc3e'hE|jX ]Wl'.r}V:hLzi@k4l'⭅o"-p 9NqFv~VpL"Cqr@r4t'(u v ۦw`zVcxL*oy;Az5.{"(| 즍|r" |25}yV-/L>Ac5O)3&+ dGFU^K̉bA95d戁)xԇ τjDUfKӮܑp@K65n)Í۞DDy=Uh>K!?@઒45s-#)֣Ԡ*i$(擂U0Km@ͪ5x)J a=΄%!Ail_n%kaZmdoPg mKpiQWrXk @sl&$q=n7/zl!>ekhKl3jnLllokn#pUpq>qcr$nEsoypzbwqCewgx}ix#*i+}wyT^]ačd% yfK0ehPj; kk"g"wX|p]J`Jd(bєx}edUg]OiŎ:Fj";ekv\9H_:Taw0ccHfgNh֕~9i!dPvqڭP[tj^pi`vc2bgesNOh9Mh!c`hv GZ]qa``!u+bae#Mg8h(!bdu q^ls=a2t{cvuwfCc`vhwNwjJ9(yl8{wmPxmben;jJokʈZqommFvFnvrs,pVv_qvKuswY6-txTqzx|v^i ek(+l{q5nc~]p(~'Ir~35r~Sco(|{xzcgbRiyek7olц\FnHp947q49mK9z})f mmh(,in9k[.mGovC3o kֆyȇghݛm jZ;lIGn_3nɏjy2dAfV>~lh~liТYnkߞFmŚ]2miΎ]Oxc˺eն,}g.k?iJXk\UEm72bmOrqi(x]zf^z`}{|cCl{eY|gF]}i1~k}m)pXviQwj|\xl3jwyLmWzUnD{o0:|sqzr5ttsʋZu5t~zvthwu@V#xHuC+yv|/zQwxw<wfq~)js,~xt(}fu0|Tv|Ax}9.7xv}qu|~zpBq}wr1eXsS*u7=@v-v߃st!}_}n 'p?3uqU>d%rR8t ?ux,unrp"|f͓mo8}tpScqQcs*?]t\,tg&sq3{vm2nusoBb:pӟPrs>sė,Zsxp6zl"mroLapS.Pq>fs5/,r闰bpu;z/]`[r babe P3g&=݄)i3*kl[ssh,iipkV_4lNmHz7zʏ&^z]kxe]}셉vUx.vڣAhwd1Xx2H:yQ;7z &7ysw͊ |7uٱwvWhNv㩈XwGxҠ7(y}f%x۔w-|jo]pu)`fXdbnV͉dF2f5fh"kI l v&g\sʈ6i e/jUkEZm54Ro$!p Wq'xERpr2qcɅr^T3rDs3]u!Hv ov${=}Qz7pzMbDz5Rǃz=Bz2{ { qz}7|Co{a"^bQA1{ + W~zinJ"`68 PāuA1E . $ylv~<~x`/l: ^Nnq?-09 0 7}a/~tו] h`_ZĒaLIc=#f,hj]lAxjsfzgj hY iKfsjenZNnN.o@q2ϕ[r$tkGtMv }d!v\YvMI&w^?AxF2ڑ͆1s4#3 abHW鐭K||>uގ1Eh#ڊčf:{au2W6)K"a>)06R#w_I`6VʑJ=:0#d틫ˆօ~Zw[gOݧ]DS_7b *Kdg T1hyn{YldOe}Cg7%i *tkh&m{ ]nCr}Y\l738V՞ɎM&͍B 6+j*,Ҍ3"V`LʜLAΚ;t6c*אXԔT\t~dsUHLlA;5Ř O)2ʔ**]YMnYCM=[8Z^,` ?uc_e6)hsr}!M3Wb_{\boIPdԂP4d_n|z&TŒ X $Z!n]׌G[`H/c13b]^Y|}pYS3VYmP\{Z_GG^aݐ3*a4j]{RUa~?Xel$[k7Y^F`ʗ2_J\-}{CQ2YwT}'WCk+Z~X]أF _x2E^[_{lhX_/m[loX^mpa{[r@d$Gtf`2t{hTpj l.gcҏ:ie}kgkmLiY&oJk>Eq5l1 q~nmoAp㜗d`nČfo{hspijmqWalr_D;nsc/ntktZtϚ"awyacyyeyghyUjyyBlfz-.l/ziyIx _aYxc{f^fT+hAjx-j{Fgl~{?]3_1vnbddpS g @hЇ-`h(/!f~R}Ӕ\[k^9wu`1cc #Ređ?g|,f e 0]}Zi4]s_bb_Q@d?[fj,ef}d>}6YF\Us^ʩaaePdx>e,*dfc|فCtXlug[t4v'^ cHw`Qxuc?Vye+WzIhN}xiLpOp]bςqdrrfashPujQ=w%l)wRn/ unosӏlmKn1n~poo_q p[N^s qB38i-ބ kRm@nYxt~_jhr~lZ~mL:n==o,~qdr@sc{s-{sf|&t`Y`|tJ}uq;~v,-Hw&x/~x>} qy|ez%|X(z|I{}:|}+x}Y}|}a t}+|~pFwˆ%dxW3yeVHzz:{h*{{~ {Govfcw:6VOx,'HyK9z0W*zpym Az7n/uPdbv2Uw6Gpx[z9y7*cygqxSp ym}tb#uuHUv'Fw8x*xwhZ y *kWL_8Z(RX\D_d6.a&wǀf1}#NqHG~Ʉa~0W~Kv7>`1.e#f~_~ k^'VS>YPGO[:^s,ayc nekIy]_dRmaOFc9:eT,g%j8 ky3o{\gQmi"EِXj9K0lV,"#n@pZIqDt}Z[pP}pD?r 8sy+uɍv+ύ-v{[y+Y܍NxcOyD/y7݌Yz+{k{Y{|Xۋ&Nߋ=C 7S*ÊB}ICC_PROFILE~X6N7TCԉ6*6߈yۇ0W^MBh6p|*3.Z<<VֈPMs3BK1l6(* va MQLU`GLPW<8Z0U?]-#`  bhen^{fP]Fޝ_;a0Qd,#㛐fi)E?k@rr}*OeFD#g_;i0EkC#ݘmroJ Sq#v~OBmEo;p/rS#Bst "vCyNyvE"w:x./6*yK#k>zzs 3{7 |ME~DTS:1.𓟀#c6 .rQM܇D9ғ?Q.V#j- rarLzC9>.M#r 玩 !_#sLݘCz619U!.J#K8 !aMDS:EU0vX%rd[`Z^W a/f3qv|C[:ǩ]0ʨ_&&be ե,gknu"~6Cc:eO0gY&wviE@lNPn 5qhx@CWk:#l0wn&ppr)s+vzB꣯s:^ t0ԠjvT&wϝx\y-{|Bq|4:M|0}&~0(~r@~y~Ջp-BR9ڞ0S&i}= AG9~0w9&bJJ  p؄XXKaAC49cp0Zf&—XO] d^eR`VcYne+]@\g`~Hoic&3`iecofiX^[Q[`~^7c%l`eYcgFwei1dk`l!mSiWk|Zlj](mX`Ho DbPp:00`q^;qZq1OtvRSeuzqVuhYv VP]Iv]CW_3w/]-w?\VvduߘLA PD xdS~fWM~*TZ}B\t~."Y}Z{Hy]Iϊ8Mv~QSe1USZXn@Z-^VvZ ({̔vGsd"Kr;tOK9cS-R+V@W,TM7Zs}EIsdMfbyQQ&T?=V@,CRZԈ>ՑD>XdHqhr3LaiPPCSv>T,+Q [YKfTE~fRR}gUuinYYdkG\S mh_@pob,:nre lf2l`]Ub_tdbgbg%dQ4if>kXh*j]k"iikp[h5^`iq`kQaclOfLm=Ggo~)foq/gptDWrZsSo]t_)`tyMcTu;dv9(bweuxT|}W|n Z|]]|bLf`|:b|'_|d zwz͉Q?{U8VlaXmd\[K<^A9_'_\cbP}-Oz0SHjV{ZYۍhJ6\9]`&Zbi}~M#xQsiTYXYFIV[8o[&Y@eqbLwPFhSآJXW@HY7Z&W?bىHmR1zSnUjp+YZq\fJ.s_[8tb%tld u$eoÆ[h\xFj_3ikaY*mdHof7 q@hJ#pdj rfk"scfv1ehgjgj*WrjRkFlm5mn#lp opYw`4pt&byqeodrlUg[sE~it 4jur"XivG nuDy]zrF_zcb%zT;dzD(g{L3h{!f{ lfz|H}Zalp]!bJ_IRbC&d2eY!Yc) 6k~~>|X-oD[a ^ oQ`ڋdBFc82)c! az [idzVsjn%Y`\P_`Aan1b `{ oiLZyU;cmKXa_.[~P,^M@`Y 1`ɔ b_a{ Wis{uR'nMvmU`wFXQx\AVz^0{"a{ dQ|frypp\*lzq^^fsaOtcI?v{ev/Vwgwj(ykYv%wGlhejmgu\oiMqtj>s3l3.CtnO\s9ouw9pwyuAho"hjp [lqpL]n~q=,pFs)-Iqtouru.uc{sXexkg"gxYiyKl yt<mzA,}nozmPz =sz(}qceelXKgiIih;.kk+l_k1 r#~<:pBadtc}W7ePIh+z:qi͈s+Wj28i% qo_VcyaVQdVH9f_9hP;*hh: p*+nD^!Tb`؞pUcuGe9Bg2r*}g^:gD on~MRb_~SU]U$~XG)[8q^_(za7 cUfunlyZ[`y]Sz`RE|&b7J}id'~@g~uiy kxQju.d_v!f_RNwhgDxi6&z,k&zmzo#}Uqziqm]zsnPtoC(vp5 wTrk&wttwtn{>u|gonvU\p_vOrwvBsxE4tyH%xu9zu3yyz^~elI]Zn&NyoAq3Xr$rs0~x"~dj>YlHMn6K@SoӇ2p$qqvchXjʒLlː?nl2Co $^o2p[>vAbgmXKiL)k˜? me1nk$ ncCo|Muaȇ=QV|TJBW=@Z/l] !`{sbVgw`/ZU4]I((_g'^(2Ɍ`&cf thom{RaHc=͈el2 8g%j;8lH n:Zs}|Q{8iGk7<Ԇl1~E  :Ԅ/8$KM Z.%7Mu|D}u:I~t/~ЊL#~ш~v, ~8g; L{SYD|9}hW.}ɐF#}ō}V }†a~eHMO>ҚR}4g)Uc)#X\[f^/bn-{G}W>BZ4+\)_R*8bSdThr=|Fȓ_=a3c(͒fa1i 6kcnj\u~zE:g<܏i;2k/(VmhioqVp3%s'yEqo<*kq2lJr'tQތu`vJx{Dx;5y31)z7'{NJ{G{ۆ|a}CR:Xc1_'TшJ̅>NYBx:։f11숻' J 0{B2<:^1 &Іr# R:M72DP(S!V"TJY?Cb]/dTq|P:U2GW(ZV]~` HdS it}:j]V2_G)a3dg| jyowN9ke 1כf(ٚi<k-m Bp t2z9h~m1n(prl-s <#u,x|8˗ut1,uv(}wx,y ᐈz2|~w89~0Ք}~(O~ 2B |}lՉU7E^0 (#9 -4ȏr gjjk7L0A' 펣E {wτ WLYPbv\TTjes^XqSa\ Ac_.,`FaX`Gc ip_P]e+Z%gY`hSm&IbModrQfaThP Xj=Y l?)TnamqՏ1Dm}0H}npULo_PpNUSqLM9L'J%c|d{7Py_o.{`Bq`rprytPsh!StpZVuLBZu=C\1w -\/x&N]xD !pw|5rL$}ZfZO}PYS}kJV}<(X~M,Xv~i} QpA| ~2pH,dLWPy?IS;3U~,U1Y΂ {ooEۑcJ zVMZHQ:aS o+dRAX oׂn{CbHUKGO,j9P*PW uprPn+Le8o#PeWpTI@rkW:VsZ*,t]s`yucrogV}ci9Y/UkH\Gmj^9o"al)od2 oflxi um[a_ad"aTfcFHhe7jh0(Ekjklawn<xk0]h_0_jLRlbMkDdmC6fo$'|fqhrvss3{jiXq]p[rP^sCzat5|bv&bwCOfwIuw}{gCTz[X!{AOt['{BE]|o4_k}&_M}=d|oVuJ| -eQjZzUPNBX*QA>Zʄ?3\o%~\ctWddN^Y^R_MDU@aXS3 Ys%Z]a݆tpciLXP\L}SĔ?Vs2wWd$Xˍla @twev[LYwPEMx4S?yW,1zZU"1{]e|_3du'cqpUWqTXKr[^>zt^0v`!vcxfe~.jxaej^V lk`JnRb=2p'e/qg qj,(tk|o(z_weglTWhhH~j9jf;ll3.m{na PmpOGqq{t|]aoRd7pG"fr :hls-iu2ivLov`czGx}~[^xQn`yUEc'z)9e*{,f~{Yf|m{ny|ZZP8],D`7s8bM,KcKdlHDxY`W~O<[ 3D ]8_艨+a2xbj/xK`X~UƔNY Cb[7^+A_RBaVPjx8Y6LhN#OBo[S56cVt(ςhY̓\ "_gw`W@y1U7LzWA9{3Zw5&|m]B(0}`9~dc %elfyUs]Ku8_@va4wd2'wyfiyij |wkzp|So[eIpgS>ri3sk?&tmuhod yp;u}RDkFmHBm,o0=np2pOrx%qLtru aw4u~BywPgvGiws<|kx1-my%^nzxoLz uNz||EOdUFf;h0yj=$kE~m! 1sX\|~NaE Ir{lM_leDbz:\dh(/jf$g& jF q<{DLKBN7։BR,OUPX[\2Z`ky5K,SAvmVy6Y.+΄\"_FaIBf oG{iI}\ @@~^ 6t`Z+Wc=2f̂hBks~}OHryUc?zee5{ag*<|Fj}l~ n!pw~GuFk=vmR4 wo#)rxq=y`rzs?}vzEqt-}瀟C%i:kR1mL7'pno_PsBzw\}?ʔI6ɓjM),\P["SV ]=Z `mz>$R6T, Wl"+{Zp] aCInfq|=Y5B\ +G^!҉ayd 2g}Yl7u~L<3a4ec+.e!Ahz"j mE# qfx;ۀit3k5*|[mK o`LNq ؂tr܂v`{:|kq2}Rs/)~t M~u$~v <xz}9y/zV2zF{5)W{{{|h|)| }}4i?~9&vk1w (xyP,y1 |&\~ 8tJ1(u(vЉ&pw(xRy zH}&0 2%VG**Jr M#P TEZ]dLp|1ݛOZ)9Q!6T XM ~\ aQht~}1fW) Yo!\=۔_~lb gGmw 0Ɛ^) t` ĐQc\fg?i'Kl0fr,z0 Wf(ah k\jx_mto/߈rbv|/Hn(p r`st}Cwz~.DwI'xAЅyOy?z-|M}-'@QBh @#Q-~a&Y`,lcXBhmft2 )h@ v b K5!~rh^UNHC ?!<":#9$9%9&:';(=)@*E+J,P-W._/h0q1|23456789:;<=?@AB'C3D@ENF\GjHyIJKLMNOPQSTU.V?WPXbYtZ[\]^_`acd e3fFgYhmijklmnopr st1uDvVwhxzyz{|}~  +5>GPW\_abcba_\XSMF>6," סĢr\E-̬fM3̵jS<'ؿ›Îăypic]VRNLKLNQV\dny׆ؔ٣ڴ3K]p1Uy9a P zQ+ ~ S ( c>hF%sY? &! !"#$%&'u(c)R*C+2,- -./01234567s8f9[:Q;G1?,@(A%B#C#DEFGHIJKL M%N,O4P>QFRLSST\UeVpW|XYZ[\]^`ab$c7dJe_fughijkm n)oEp^qwrstuwxy?@yAuBqCnDlEkFkGlHnIqJuKzL~MNOPQRSTUVWYZ["\3]E^Y_m`abcdegh,iFjak|lmnoqr.sNtnuvwxz{0|P}p~Ё.MlƊ0H`vȖۗ )6BMV_fmrvz|~~~}{xuqlf`YRJA90&߿°åěőƇ~vnga[WSQOOPSW]dknsyہ܋ݖޢ߰>d ;l F%U~l5`f* J  zHR&W0 zX7  !"#$%e&J'0(()*+,-.{/g0T1B203 4556789:;<=>?@xApBiCcD]EXFRGMHIIEJAK>LY@ZD[G\L]P^V_[`aagblcsdzefghijklmnopr st(u8vJw\xoyz{|}~ %>Wrƈ"Bcɑ4Y~ș:aա#Jq 0Vz%Ee¹7Rn¼5Lcy̏͡β%5FWhy܊ݜޭ߾ (3]'Ko1==. Lz~|"~1i~<}h }Nˁ~v5H~~1-}ފ*~+t~~f"MĂ}5M|Ϙk=|Oș}c}~ь}70eegMAA5~킂{٤{Ơmc|LRx};3~&$|h~vd8~֍ML5~g*{={8p{ͦ"| }l{~c3~f-L *5}zjz嶏µ{|Ԫ3|oC}N y}bb~ K~ҏ&6}z_z;{F|5} y}ga}Ț~KR~]6}Sz*zտ{)ا||ݱx}5Uaq}K"~UL6}zz#{Ͱ{<|x}ja/}vK ~06|]즈}ć}7|6|؆|xx|a+>}I#~c28~ڇhӪмDžl}'%gvႮ_΄UI J3)MUC520[l.Y`|وe,h׆UwwC*2*ԧĥH|UGhؤUQšC)2́Ӛzﶈ{zˢזOzҎTz{:{)g({S|@^~U.5~Ǔ]՗AEs+GAXyޑ1tf'Rь^@(y.|GŖُ_FFgxSe R"$@1J/ؘ$ q_Šɑw3dNQdn?щm0̃7R?,s:u c͑VPЊm?ֈ0p.8ŗ}E’Nb꟢ubOa#Pa?[0Ą$eխӲɚ|+tfka،}P)c?l1F徏ZÖ|s܎8Sa5O?1=ʗ_唲ť1x+bsna@ơ*OډЗ?1e򹝤zEӡZz0Tz?[]ziq ;z^{TM'?|;_~U,8~q381hJSp-+^)L66< 8.-0 ؤ^YXBq%o0L]lL@UC< <-ވ|%fϔuǑn\dKˏ<(g.|ʂԳ6`S I[~6VFa8G'+{SlpvˠfDPV&/FŔc8 2,mtsH>mguޟύeUg/F8֏"3-', ~p|q(u M=d\UPFe֊9\-ǃM\ ϧtZ՚d1kTFC696n.8,H,B%ԫ!s̞pcʚT{˕0F:ˏ89a?.ի}.ssY1cƞT_FA9.QeM M+scFTAb%F>Z9/ œyֳy}_ymߩy^z]Os{A}Y4ZH~>)~ⷔv q|孰m^YWO8A[4Հ*4? [|Wom<^QO|*&AҘ925|+5O$I {Wlw͌{]vOEGDAE5ꑖ,]V簈<{xPk5]O Awz6C#,2;QA%zq>kvw\Ҡ/=4L,d\~]pUcUKI搭>jv4,܊'.wI~ )pbtUޘI>84q-97#}寃p_lbѫhUϤI(3>Ž<5Ɖ-~k ̈́ytySgȿyEZɸyNT'{ B|7ɢr}.JA~&~vu_Wh w[-(Nү/C368/ez,(ˉ u)#RhC1[xӅxO9;CȄF9V:$0Z)KxŐu23hYh[OxMD$z9f1!*DUu#>h\5e[ODo;:^Y1+ lȁWjuhPu[IJ7Oʫ8nD:œ2H+gr٦rth?؜[ʲMO쪘AD;gq2H,/Uxth/\[̱˛!P E!p;a3 ҇,IC2t8h" [бlPėwEAK;3F,݊Wd{}y{y|hy+}gz1~Ozg{0~zc5zK'|E35~|uywؒy섙zۃ,|E}yu}a~%'JLN3^}~wxyb zES|w|`x}]wI~_3}5>v̞wxz}{=BvG{4_S|H}ȇm3|vѶvbx#Ay zzt{V^\|FtHu}N_3|7uAv? wMy~z3sz晸]{H|3{مJtuXn_v8 wo xȭ;yݦsz]{G|*3{\"u1γv Tpw?0xyrzW\{c G|_3{Q:u'uѦvw'xp,yvrz-\d{6|#B{hagCplS@؅+/ =ca^ۑ&`yㆡ$f 4R̅FL@x/KٴϝNі@xvd-RC@F0DnQűI7l碸gwd QO@j0_\ j'~v?chQ#@ 0?H¤ҝjىۭvc.P񃻕?x0Pxа(Ż†P󅺳u۪b%Pƒ?1xeuuvvv/w~8ޑm)؎r 8Q_|MŠ-\<_]-ޅ~єFTʖ#5T"pg^|MlH<ɇ.aJܷ@[ϔُEop͐]&6Lڊ<.̃\'~ *Wn_F\ډLbI}{}G}8q|a;}Qٖ}C9?~551*4!~7f Bdp2^`QdC26+Ur]oE_Ș+P甯iBO6V+ӈ nog{~)n~G]^vPhtBƐj6RH,jLrI읣}so.mԚ^O]B6Ƌ,䆱PL,_|fmGP^ xO͒,Br6,-F5pyV|Tħl՚]Ֆ<7r{A2D|'эB}bB}2|uҩZ|vgR|jY|K?~~ >X~2)~$d`uJDHfգX݂Ka>܂3=(*E&N҂tqf?X=Js>܄3y*ԉbe HUtȐeWʝ/J1>Y4 +}MHKs͛s~@eNvWJ{E>Tu4`,:ۦ܀^s˞SdWOJq>ՒD4T!,r􀩪rodWJ`)Q>a4,LJ&$^N߯drn8d^^V䛇JS">*4-ڄtOxrtkvu4^1/vQHfwDy9w9{x/(|&}uY|x|ka{^5|Qa}E-`~9~0~(*~򄱻kx*҃>k8Ph^Qe8Eb/:dE0ƒ)׀7E'"wմ܊VjV]ܩ{QLEz:"/1d)ŁDֹmw{{jq]{Q!QE:2`1䐠 *!g固wjTꕢ]sQ,E];>lE2UJ+J9Ճ wvг sjgI]GzQ }EՎ;|Ή2DO+f̸vi߬3]$ QEE›h;ZC3̇ ,@؂nvreci \PڠƗ]E;C3!,a,yl*t7mitza1kuU-v>Ix>z5{,|%}yMƅ{m\{~ax{U| J8}4?!~*5~-*~'"]~yGwmiamUzJu@&6pH.(Q+y>mˉ5aѷ9V 88J1F@W 7L%/fi:)FՁ*y%4mڏaٶ@ V*8&K @֡I70f* yRmwaҵxV8nK5XeAm28";<0*5xŠsmqhaƴؘgV>˔UKU;AMЌL8u0+*-xZmXa\VAKKo;A~\81H}T+0xgmBaVFKAc8ߗЊ1}1+Ո݃wsuϧxt +y=tעtzuŋ{vt|?wq^1} xJGn~*z0|{tYv wy~lx~Yz+}sz}\|}yF};~1 |)}:s tpvUKwЇx0qhyꃧ[X{DE|l1L{}7ݦqȗmȚsPu>vxAoyZ8zE<{,1qzlpAƕrItEXuKJwJanxqYIz D{61zw|}p`&q׫rtu̮kwWnxӚCyZ1y]wqrūast́ulkvWywBǁz4.{JA}}}}R&~}"R||j|}V-r}B}/ 5}\{}|}UH~~~iV~тoU A_/v~s9͢zƔf{y|YC}&|V}@H}q 0k|HBYx yo1zDvzw{ldC| Q} @4}?t0|Fp߈qɞr$]swud4vQ(w>k$=Zw./wAT'oG' ȃqy_l|M=Ӆ. Ԧ􂟝{~p^2ꑇM0,.x_f&VĆ?3GSU9ƃ.WdWEwx-fVpGg".9ƃN.=եMopȅזqu_ss dt7T͐ uE@Axd6uz)E {™_yo4y-ytlycz+S{0D|6~d}*0}L:[s<뀃b#S/ڀoDD 6O-*Cܗ6-a*q aڎRe NCދ.6fb+݀Mo\ׁPoFpO` QQCk*6ЇO,*Ӟ)ћRvݗp"`7mQʍCRى6,}HlqovO;_0jPߋb_C-d36{,݃%]ҕEԎ%~#nߎ_M䚪PcC!=71- ˃>(n~nEna˥^댲PeC܏7-Qhof塇pz&kqk/r\8t*Mv6?Dx2z'ߊ|Ǣx%xyy jvyB[yM.{R?|3P%}(}ϔx'iZؕLĀ2?ҀY3)ԇG< ψw߇1hZUL>ᄩ?cރ|3*Ņ&}vÚ)YgyYS犙KƑ!?D040(+'݁n{hvgHhXOKTz?6_4s|;+AfiٜufjXٓK8 1?24,ŃRЭHEȨtã)fLcX7K?7b4Ĉ,OdמћtqeaZWSgJ򏃓?'M4ՈUj, bo-|`pCo#Hq`a{ rTtEGv:y0/'{ &|Gw|'xnƤxSa%xSÜyF{{;|0}}'Y}`A{on?`a~SeOjF՗};GQ 1R(K%[Wz¦m` eRUF~;eB1@)vhezȎjlˌ_RhFw;~aI1_-*YJmy2l~.n_(RQFB;b2I*ᆣ7=yl^ӜwRZFAj@;02+MۄèFxΤUbkǠE\^sQΗF, ;я2ϊ+\cxukv^7ϝ`QF̑F;͏f2d_+l|XnqlodQqXarLmtA w$6y|-A{$%T|k|hw'pٱwRdwXg|xLVzAJ^{7|.}r&}{.~pg~vd^~>XJ$~L1A7.h{(hN{ p/Ld1CX PLo݃AڃL7ZE/@;(Wi{#0Goٮmca)WڤLF3An8*bx0O){RzocIWkL;:A"8m^0x*@˂zY o66aceWٓ"L4IAИ80ڌ*@znȠ_c3W\cL-1 A8{^1&y+ԃ!yб[Tnެ~+c\W+KڔAԗ8+Z1D,|+Szp‰neoZpOHrE5u ;ew2y*╠{B$Վ|pvvfv[wLPxE)z8<{3p|,}r&;~ pĿ}f$m}[ET}Pr~IF- 6S/ύƅ*݇qBغrmt\nhvorwqlxrnkyt.Y {)uC|9w.{Ly]pDyAryYsyjuywzlxPz4Wuz zB{-{.z}{In>bpArP*Rt-?u5jw KV-yBzB/.y}lĐ%n펜q Qr^~8t-irv/fUxGAy/Yy7vΝk<&m p!Αr l|s3h3usT8wAx/}x̭kֹamFvoqJq_{sg+tߒ|Sw @xaZ/xX]jvlínopԣzrftmS v@w/x}j1>ljn=plyrftRve@pwn/wȄhjl7×nMLp'y-qתes۠Rxv*Q@Vwq/wȔ{fk絠|!mg|o}pz$~r#f;~sRue?;x%,~y#xw{ywvzxPn{xx`|xd}6yXQG~]zt>~{-1}{w x6uylWzsv{,c0|>P8}bt>}O-|}uvrx:&yJ'u zYa{/OL|=|L-|>{tvΚwRׇ xcsyE`zxN{P=n|P.{s'uVPvwrx _yZM{Z=;{ȇ-.O{H)as~tөvw)qx_:yseMz]={Z).yz0:s.ҩtzuv§qw^yMKz8<{.z`s0tG9:u}"vOpgw|^Rx.M z[&l˄Z>I΀Ń4:8F,~}C~1Ϗ2~|~Ѝvj~3Y\I/: ,~dدt}_}}u{~"i~XX~IH|_9-#}-|4}}ez}i.}ٗXG~H`I9~-]}(|LA|}z}4h}{?W~+H1~9~6l-};h|#J|p2|űyW|g}=W|}G~q9}-}9%jn-l-JmxJo~g;qV숄rF҇u7Wx)TOzrt̘ϊ$u_qv+wOvfMwxfEzL7 S{*(|]"?~~܈~u‡G}d䆌}PT.}ED~7B~*Â0~pS?t&._cqdSHD̂\7Z+Nd/SsVebQÉR„D;7@+šeɓݘɂVra"ROCp7!,7Ϡ}Yڂ ̝qH%a QzNCY7 ,ĉ‘I'DipŸ`|IQl#C7(,xWyh³*o`tQ@CbVb7.,:ڛ6.j.Xk}גmnRoA^pOэ|s#Alv+3Չy'熱zsdt|unm[ v]ovN.xr@ӊzv3F{(Յk|Kx}\}:{e|l$|\ьA|N'}@p~d4 "~)Y~/ޑHqBمezb[/j֌[MMf)n@4--*CzUw$yTziЋZzML]?؇̈́4U`*Ȃŀ}?Dxȓ4i9Z4ۍL:?(~4qa+532RBFŌ͌C; d2r *ӃdB̘2zܕĢmL3_ٙRFm;퉤%2<+ ԆQazk~TmR_eRj]F,;ډ_{2+X@it;k~hm+[YnNtq*B4t7xw&-y%|{?rt'^sOgtZCu'NvB̕x8z.}[|&ш|~Azskzg)jzZx{MN1|MB`}e81~ /~<'χ~a~r fuNYݙց]MǖwBIa8Vn/&(}Zr׉deiFYdHM^*BYb8wI/ )F퀚|lq!ekYAM+uB+8`0PP4)΅Fn|#Ϛq?e'XLa%B38ō/0a*:{hp̞dXQ8L#B8݌0ވKT*Z{D",psɤzdhZX&LB Nx8֌^0 *̄tLiick!^ZlRnGGq=Et3іw+t1y${usİqi5r]s~RtGv= y(4Pz,Sy|& \}sUy}h٪y]ͦzRzG |(=}?4ʓ}- ~*' ~ur|hE]yЀwRGNG=ۗn5)]k-'rpwh-B]5ӆRRG=l5v[.Bx(q8g֧x\ Q鞌G}(=5.()EoWqgՕ6\h`QIGx>6݆,/)qMgHU\~"QkGt>&k6A/L*W)h}i"^jTZwlJWn@ڦ!q8Vu+0$w)R7y$5{hn^p^!qTsJĩtAc0w98^y]1{*rZ|-%a}3h[xN^_xTybK#zAҢ}| 9K}1͖\}+k~$&%~hH^ϱUTdK:BY9HZ2e,2'vh(ᆾ^ɰ…UAxKUB::ܓ,э7(7"g^ՌcUXKd>Bem:@83A-Ud(҇jCgд/^;TKiB]>:z3QL-[)Mفg^~JTKlj!BҌ:d3ӑц. )hRg}']^eHTܨKoBj{:3wi.?L)nfbphmrj֐;tKl|uo gw(pSyr?zu,ywkrʶ ms`p0tm8ruYzsv(euvR9wx?xy,xz!YiQ~yk~#Fn6}ڌ.pJ}x r!}%dXtE|Qv}I>ew}-.x|7gʱj9o+llЕmso`qNtS=Hu-vd9gihi@lrng `"q)%NsҎi=uGE-vH,d+foAidŅkrm_pMspqvm_'pyMs(lRrzng_|p\M}^r;}v"*}xVt,qNurXvsYx!tMpy)u)^`zv'Lf|w;*|yy+`|(zq|Zs|Xu|>vd| o@w{]yG|Kbz|:{l}L+{[||dpDr stmvh_[x?Jyi:hzC,z~4_op؏r|^~sl>ukZwi{Iy-:)yЂ,]z&n]7o7q}VskHtYvIRx9:y:,y/mpoC_p䞺|GrZjst OYAv0Hwj9x,yY lnƭ \pb{aq٢ is%XuȕHw/9xc,yۮ2lnzጋp zqi*sGX_u#HuwPg9x!,x݃me4BgtS*i{IkinmXpGs7'v)P8xѫQ|p}mq=}r[y~Js_h8~tYWBuFGw7y)*zSzz{nzX|zw|zf}@zU~N{XF|7^~}*}~F|Xyyzzv3{He?|T}JEm~74}*}~YwݎnxˌytzgJkfXꋙmJpg=s1Osw[&fy|na8otpfMrWsJ Qu= !xL1hzP'{Bwvxs[xPeZxV҈yjIKz<Ȇ|61|(_ }1ҋ5rNcˆ*U‡/H<1̓$)'~ΉSqEb.TG<[肔2 )qˊk'~CSp-Iba6TAGv[<..22+`)݀ɉuT0}iloatĒTS؅QGJȋ<t2MքF*Rhߤ]|o`NSo䒸GZ<)g2hmz* <|:nT`mSFڄ ;ۊ2k$d*ɂ dwfk':i%^kVQ@mDp9?t.v6w%wzߗqmw?Ko&}ICC_PROFILEj|3pf]SCqPjsD&v8x.Ԉz&{΁vuv%viw^\lxOByFCz8ϊb|1/q4u/+x$3zOv ml+np`oTqxI,s>͒fvq5x,z%և| uu;kgu`vTc@wI&y6>z5K|&-1|&ӆv}u%%} jn}_`}%Sȕ}H~T>~5yb~-~'t~tYjWF^ԖSQuH[>k‚R5db. (Isi}w^YΊ[RHF5̊y.(Ѓs Vh]sRH>YA6I.[")FÊ6n/)r"fh`Ξ]Y8RG>>8l6/+)͂ł]kҬBd!aߨ$fPWyhM9k=Cynv9ur017u)ǎxd#䊨zkGlGamWao=MMqPC(s9v1y*#z%+|@jҧsaD-tW.guL眭wJC'y):(z2:w|+u|&<}jXR{c`颷{Vԟ|,LV}C}:I~s2.~,~'~i֥`V}Lr@`B:a2 ,L'΅iU[`1{VHuLGd6Bꕽ:u83@C-Ɓ(_(hQ_ޟُV EL!vB :3q-'(҄Uh_?U֛L! Bz:{3Ҍ -ه),1hC6_~՚bUM/KӗB : 3Ћ-U1)n:`vcWfeN,hDE.kQ<n4ќr-ߖv'x#=z`AkcW~lNsnEqP=;tD5w .ŔyJ)z$:|n`&frWsNu#Ew=y#6z/|)i}%}` yW.zbNh{YF|y=團}u6P~0$~p*)~&~_ۮMWށNå(4FRV> [<6Җ0|+`&%'f_-Weχ[N&F(\>6j7"R1>+VY($_jEWF&NWXF/_>XU7Rhj1b胺,UV(yE_4W%K(N`F3z>q 7ه*1a,2 (؅#_rW͖N=F6>7j}1,҈ڃ)тjN`dlbnepht rlk'a$tmNvp<<.ws*x va+flKui{mko.nprp=r'_[rs{MuFug;dvew+w,xcwfxixt kxpGn`y ]qJy{Ksz:u?{o+VvmzaԂȥd%gw&j$nl\p tJro:otL~+u|`,cS f#@hRm)k[do^J=q߃:s~+uK~a^옧b\d~+gljZtn2Iq9r+tȱ]򣗠|a+d |fԘ"k'j^Ym0I?pP9ri,t]?5`wcW{f-jbipYMm Hp K9r,tF\ϹҞ4`bޭ{%eiiXlFHo9qe,0tdrx_sbv]uJeA|vrhkqA1>uJ&x+ibrk;wlh>-nYpfKQ}r=쁖u1x'bz0}Ps}su}tf~^u]XC5vlJ^ x/=hd`bgS0jmF*m:q.Lu%{-xAhyzjlӆl}__hn܆Ā|5؅ .Ez'ށu<"7k3r_SSׇzH<>ڃ5HU.m(Y[tg;jtX_%SZHe=<>*6 X.c(݀si⇬C^RZJH%>p$6 .Ёu) {hs9is1;^6{RGQ->QD6Q.ہ6B)A4n_3daZ=WdOt.gE k;(o)22sS*3v#ňyxngdYDiYʕ kOmD*p;t2jw*yg${@m=goc;pY22r-N]sD[v5:;x2pz_+~{%C|lbwcbӓwXwxMyC${I:ً|r2މ*}., \}&A~k b&I$W}^MqC:3,}nV'eq+ja7dWjMCl:ۂ3F?,䄮'ʀjaSvVLɍCNR:‰r3-P(WFiC`VLsC v:3 -(߁Xi"0``&ViL>BQ:(:3*-I(灓c^ZaQ drGg>hk6Po.Ґs(Bw,#tyc fZOzhPak Gkm>ՖPq6tv/fwf).y$b{bbnYdoPtqGs>єvE6ّx/4zp)q{%q|b}uY|vPawG;ys>z6|20L}*@}&N~:av}%YO}P~0G~>$7tN0@+-G;'?`„X0gO͖Fړރ>݂70z0ہ0+~'`iċXZFOhF>7[M1U",ށ(o`XyOV FiA>o7!C17,ra([K__W O7Fl>{7z1,/,1(X^HPaHFPd@Kg8̝l1ۘp|+̓tk&w"zXe fP hHj@m9[Nqm2t,ow'y#{XAmBPnHp@s9TvW3'x-~z(#{%}*XtQPuHw0A y9z3{.C|)q}%~WWԦ{bPrv|H}A}:\~z3ڑ~.~**&PWnPMA5~b:G4߆e/lg+(^eZ,`h&]Rj|`}ld l8ogHZqjJIzt$m8u7q)vvua`eܟdNgύgi{il!jZln/Xop.Hr`r7su)_uw]qar dszg thj_tWmv$Gpw7ry{)tyr[+{˚p^{ۉa{xGd{gh{VPlh| F8oq|7-q|)t&{Xc^\z_ӄjvcD@eg5NU?k'EnV6p~*"s}>W>Z^SuFadfTXjLEmn6p *Ms1~XU؛Y]yt`璐ce*SiLKDlR6o*prߢTʦUXKt\1Es`bduS&hDMl 06o2*rءT Wq[kr"_b!chRh1Ck}6anA*r_mrYҕo(]p`jt]r_cdtZfSvj#D;xUm58yrg'z?uݢIiQdc\)yfMs{ljC?e|mnq2|s&v}v0q`d/qrfuxshiujZwm,LCyxo>zsP1{]v''|xnnGoow@qIph)s8r YYusoK+wuw=y/w1z+y'{zkwmTxburo.xfq_xXsyJJv>z=jw|1y,|p(8z|Zim\klsmzWeYoWrIu=v1xZ~(z7}ˍ}gNJi}rldLnV9qHt~xG-Sz#&<{yV|%tn]|ub}8vBVu~$w2J x?zh6{-x|j&|wz+}&m1z}=a{}SU|}J}~*?z~R~6~t~-~~h'q~=vx~lAyy`zovT{I|:?$}TO6}4.}"'~qHuwik_xX_yowTBzI({ч>|6|h.N}U(:}#tvvjwy_[xSyH{&m>{A6|VJ.q|(}t6u˞!j&vڛ^x#SVyHzzW>{|X5{.x|(}ZSrHZ.g]p\ `QwdFg<_l2뇒p*yu#(xKpÉcfeZ[͈TgP҈jZF"my< q;2t+w$z/ok_ezjlZކnOpEs*;Ev 32x+*z^%{nJs^ddktKY؄TuZO$lvDTx;vzX3{+|&b}?m {9co{Y|Nv|DX};5~"3,~O,M*~V&~kl@0bgX[MD!:c3b,p'x<dk9 IbTW݀UMfC :ɄE3z9,ځC'/j+a|xqW^MM/CthQ:ۀ-3I-(eV((\i~ka ~ח.V^L̏C>:3rH-5$(aGfZ]c]XS`Id+@th17#l/q(u"xegbv\dSag]I{6jP@8m7 q/uh)LxC$*izd֏jX[Kl R}1mH.pg?sW7AvF06=x)pz%'+|#cWq[SsQċjtHbv]?Txi7yz80s{*I|%)}wbycZazQ/{ G"|?:|7m}0~*W~K&Y~b!YÉ\7,1b&+'.9`݇ΏXiaPCFP>Lc7oB1|r,*'߀ǀ`jXœdOk@Fˌ>ω7k1s1,9((|>[ĞYS] K`tBdL:h3=m,rJ&ꊟv"m\y[5)aSLd+JxfBRҖ=kJqJ?dsB([v :x@3Xz.?{)Y,|%m}Yo5wQxIzA{S:|h4 }9.f})0~G&J~X̒~Q:xIA:48/u*le&قX?o&QIWAȄ2:/4f'5/`h*À'K\AWΐlPˏ6ZI͉Aw:ۅ4&/&+>F'WpPH8ANqL:L4/+TN'䁣6QY,J\}Bx`,;Üdv5;i]/0nc)Nr%l~v!ytPZ`J clBf`7T3bWׅe[uFhG_dkpcTng*Dq&k15qrp'ts[_B^3b"aVdssdgchj^Rl7m Copc4q[t't vm+VjZ8l+]mqaoaveqQjrBm6u4pw(8s?xSuVuZvxo_0w_cwPh xAkz>43lN)ApŀgT"iW{k[lkn _]:pcxNJsug:?ubk2\vp&WxtٗPb_eazgdpjjgF[mjLqm?sdp2uyt&ww+^uibaTk xAd[li,gnZJkp{Knr>Qqu1t;x'_wy@V[sF^y\"0u_i1cB\3v{0|,@|}F&}}m|npcpYosNu9Dw#;}x3qzAw,z{'}e~l_m*boyEXqφN3t DUvl;OwՃ3sy,{Uz'a|kykُb3nOXpŌMs|Cu;;!w3rx,zၭ'|=jj3amvWpMJroZCt:v3Ux,z'|Mi׆\UJ`XV\K`Bd8pi0Mo7(ԄAs"+whr1]_ +`UcK,fAHj8+o0msR)nv#yg~f)](h|c+}sZ'g~\La(szYu{mP+w5G/x>y7}z51.{+})'~^ꎎULVaSYM\D`'oTp;UM*XEwi\>a06쏃f50V!k*p%u!ׇdxSٓE\L_E8Fc:=g:7&k0Ҋpe+Wtw&w#zSS:dELfD单i=̌0m17*q1t+w'xy$${RkcKOmtDwSo=r7u1>x<,Moz8(!M{$x})QҊr|K~&<P(J,Cw<兺61}Z-&)Ł&iP ܇5IڅچC@<ńƄ]7Ѓ@1ƂL.*8c'bOތ\IC&ˆ<6))15-}*J'FJ#JTcC:XH=Z\7Van2 f,Րl([Kq$pu!pxJE\C_&=#b8Ng}2:lo- q)ru %x#"†zIƘc0Cږe=WiJ8:mX3qi.9t*(Ew&0z@#܅|ItjC"l=ӑo8+r3u.~'xR*z^'Q| $}[I pC{s =uU8w3,,y.Lj{,+(|y'}%y~`H|wC<#yN=\z8"0{3K|/|}+~L(~&6H-~C=~]8%3y/^,)d&hGЎoeBˍg=cQ8%3܁/ҁx,g!)_့&kGkB=Kd8$A37/E,q)zO'$МyZ&N}]R|`Vmc[]g_Nkd.@Qmh2~pn_&-srSYW)\z[_kY_occ\0cfMahj??ktn 2 ork&ru|NdYR6f}xVhi[kZ`mfL9eho>xias?1mv&qw3I^nw=NovS.q@#E q^Km+cmQUX,H^w^\x~QayEefqz9k,{/p|'t{{J0wOOQjTa]ZWcP_Dd9j;/o]~?'Ft}=Gc6uLi4R\nX|GO^,MDc9@i3/~nÀ$'}s~_YEtyJh P[qVO7\BCb8h|/unI's`JECsstIzgOZUN[4C"aЊQ8g|/\m's( hO4w&jnSRilW\om\P%r,`wCte8v~j~-WxpA$G{ft݁nbY1u e4\IhTh8_[kc&NnfBqj7tnom-dwgs%zEw]bs`efdQgZ:h7jMklB!oip\7Hrt-vw%yRy|YYkq1]mue&a"oXeapLis AomXu6qx-u y&%xzzUtonYuc^`vnWbwKgoy@kz6o{-t&|&w|SxR}mW/}bG[}V`~3Ke~@Cj-~6n~-sk~!&wd}wXOilT݅aY8U_JZd?h6Wm[-r'+v~vMǏQkjR`&XPeT]Ibk?mh 6,mQ-r\W'avwuL/jQ__aWT\SI=b?gX5lхU-rw'vlxpOlqRS`s)X$U2uT\Iwf`>y&e4kzk+!|q2#}~uv1j]Y9klc\S_n_Tqc;Ht@f=vkV4#xp;+d{t$[}Gwteb1i6hDd^kHgRnriGqxl=xt0p4vt~+yw~%|?yr'ajgdl\h+nOQkpgGorc:|nOgY}4Ek`}<o@~N3s6~K,^w~&z+}mEXc\僨YBaF~Ne2Di;n#3ri,vh&y~l VDb[UXr_N>dP|Dhӆ;mD3qł,u'#yckDTaYW^McVDh;#xnima_od/Ur&fKtiB6vmX9)xqS1zu *|w$~z;gii^OlkTo5mJqpAts8vu1yQxt*x{zI%M}{f@fq]irSltIovY@rx`8uQz$1=x+{n*z|P%}}dcy[gz]Rji{LI?m|V@kp}48Nt }1=w2}+z~ &L|w~'caSZdQhHl@ot8r1Evj!+Oy&| b_QZc,QgHjՆ?n7r-n1Bú+vy &{a]ː|YtaڎPe댷GiC?WmÇ7qp1$uX]+|x'"{^GbXTPY)TOҀGYF]=́b[5sg-m'er"9Lw`zDY;W{-\bN|Y_E}c=k~h$5a9m.@q(u#Px_QuaAVwjcMxfEDzi<{m5C}q.{~Gu(xj$:z]rPhU~t7jLvm7Dwp <ys95{2v:.|x)*~sz$|'\o*p_TgqlqLssCuu<wx"4yy.{{c)}|t%~}^[_lgwStnyKNq|zJC=s{;v5|4xu}C/z}*|~&~Z~aZRj RlJodBrW|;pt\4wu /;y*O|(k&t}4YvhRk/J'n4B^q;2sꃃ4v[/Fy\V*~{&}yXfHQiIm Bp8:s04v&/2x肗*{SQ&}1YWfPOTGYO@]8Ac!1vh+F.n%s!wVXO\1GJ_?1d 8tAh1 m+Ճ"r&ǃ\vn"냕yuU~N`N%~c:Ff]?:7j8?nX1΀rx,=bv'x#W{TzgM>{jE|l>}p7~ssd1vm,x(z$V|ySxwo LbypE5z\s'>2{u7|w1}y,~{_(|%Z}RxtvMKvwDxDyA=yz7z{{1|i|-!}})~~%~Qr}Jt~\D"v}~=vx687gy[1{nW-}V)}~ZZ&J\WPpJrBCu =-v7ڀr9u>3́w/(y+b{`'|%)}J}btDP~+v~>v~x@84y3{M/@|i+f}Z(;~#%~Ih{{C|$|>"}}^8}}3~M~d/b~~+ (,J&'tHy1Cuzy={8||\3}S/~+,2k)5&*Hkwć5C:y=E=z#8[{3|/},1~i)$M&܀tC昰P>/T9,YZ3^/ d*j&Ȋp^#{t!xuCW>[T9T_4p d/׋j?+oi'Zs$wc"O$z5Cds^>Gb9Gf4j0Ro?, sa(}v%y#f{Be=h9l04lhp01s,Yv)$yK&_>{[$J|Byl{=o8.q4V3t0I0w{,Ry){l&4|%~AsY=`uI8 wF4KZy&0\z,|*}B']~/%%~Ay=z8D{4C|0|`}-* ~8*y~'?& A<؁8l4=0c-S@*5 (O/&e*@ɀ@V<8O43H0-dO*ɀ(t̀&ـmft1!  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGW\[l_}bfijkmq޶w۶~ضӵ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵A/MGV\[l^|bfijklnszʽٿ࿸࿸࿸࿸࿸࿸࿸࿸࿸࿸࿸࿸࿸࿸࿸࿸A/MGV\Zl^|bfikllmox‚ֵ۵۵۵۵۵۵۵۵۵۵۵۵۵۵۵۵A/MGV[Zk^{bfjmojfoxÀ͸Ү׮׮׮׮׮׮׮׮׮׮׮׮׮׮׮׮A/MGV[Zj^zbglnl\gpwǹ˱‡ϨӨӨӨӨӨӨӨӨӨӨӨӨӨӨӨӨA/MGU[Zi^xchliU]hpºvų}ɫą̣УУУУУУУУУУУУУУУУA/MGUZYh^wcklVR_hpvĬ|ǥŃɟČ̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟Č̟ČA/MGTYYg^tfkaFT`iou§{ĠǂǚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉɚƉA/MGTXYe`qk{iIIVaiouzœɀėȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇƗȇB/MGTVZbdljrYJLXbjotzɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅÓɅB/MGST]^jdboPJNYcjoty~˃˃˃˃˃˃˃˃˃˃˃˃˃˃˃˃˃B/MFUOaVhVRsMKPYbiotx|́́́́́́́́́́́́́́́́́C/MBYHhHSZPuLLQZaglpuy}}}}}}}}}}}}}}}}}D.O;_;X@R^MvLNSZafjnquxxxxxxxxxxxxxxxxxE.T/`'RFM`KsLPUZ`dh}k{nzqxtxtxtxtxtxtxtxtxtxtxtxtxtxtxtxtxtH%YN-LHJ^JnMzQVZ|_ycwfvitksnrqrqrqrqrqrqrqrqrqrqrqrqrqrqrqrqrqIBH1GHHZJgMqRx~W}y[u^rapdognimklmlmlmlmlmlmlmlmlmlmlmlmlmlmlmlmlm;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=TRXa\p_cfilov╈ސ܎Պǂǂǂǂǂǂǂǂǂǂǂǂǂǂǂ;(I=SQX`\o_~behjmrzᛄߙܖڔˋѿпппппппппппппп;(I=SQW`[o_}bdgiknvߢ۟Ԛ˒ŽոҸҸҸҸҸҸҸҸҸҸҸҸҸҸ<(I=SQW_[n^}adfhjl߬r٨{Ѣʜ—ӼײԲԲԲԲԲԲԲԲԲԲԲԲԲԲ<(I=RQW_[m^|adfhjk۳pҮx˨âͻԵجլլլլլլլլլլլլլլ<(I=RPV^Zm^{adfil޽lպnʹvŮ~ƼʹԮئզզզզզզզզզզզզզզ<(I=RPV^Zl^zaehmpgпlǹs|ŷ̮Өעբբբբբբբբբբբբբբ<(I=QPV]Zk^xbglpobiqyı˨Ѣ՝ԝԝԝԝԝԝԝԝԝԝԝԝԝԝ<'I=QOV]Zj^wciopY^fnwëÁɢϚҘҘҘҘҘҘҘҘҘҘҘҘҘҘҘ<'I=QOU\Zi`ufno^PXaku¥ǀǝŌ˕Ýîîîîîîîîîîîîîîî<'I>PNU[[gari{ndLKUalu~Ęljǒŗʏťˏťˏťˏťˏťˏťˏťˏťˏťˏťˏťˏťˏťˏťˏť<'I>PMUY\ddnmtizOJMXdmu}Ɇďǒƌǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝnjǝ<'I>OLVW^ahhliR~MJQ[enu|˄ʍ‰ɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖÉɖ<'I>OJXSb[k][lQKLT^fnt{́̉ːːːːːːːːːːːːːːː='H=PFZNhQbWTqMKNV_gmsx~υ΋΋΋΋΋΋΋΋΋΋΋΋΋΋΋='G:RA_Dg@U\OtLLQX`glqv{Ӏ~҅~҅~҅~҅~҅~҅~҅~҅~҅~҅~҅~҅~҅~҅~҅>'I5U8f4SFPaLuLNSYafko~s|wz|yyyyyyyyyyyyyyy>&K-[)P/QKLbKtLPUZ`e|izmxpwtuwtztztztztztztztztztztztztztztz@"NTM5KNIaJpNzRW~[z`wduhtkrmqppsovovovovovovovovovovovovovovov@K EH8GMH]KiOrSy|X}w\s_pcofmhlkkmjpiririririririririririririririr83 @#B8DIGWKaOhzTntXrp\um_wkbxjeyhgzgi{fk|em|dn}dn}dn}dn}dn}dn}dn}dn}dn}dn}dn}dn}dn}dn}dn}6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVZd]sadhlqx膂惋倖~|zxɼv˾uʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾuʾ6 D4PHUVYd]r`cgjou~憉僔だ}zʿwvvvvvvvvvvvvv6 D4PHTUXc\q_~behlqz䋅ሐޅڂ{yÿy¿y¿y¿y¿y¿y¿y¿y¿y¿y¿y¿y¿y6 D5OGTUXc\p_}adgjnvސٌӇ΃~Ⱥ|Ÿ|ĸ|ĸ|ĸ|ĸ|ĸ|ĸ|ĸ|ĸ|ĸ|ĸ|ĸ|ĸ|6 D5OGSTXb[o^|acfilޚtؕ}яˊƆȽɴDzƲƲƲƲƲƲƲƲƲƲƲƲ6 D5NGSTWa[n^{adfhkڠrҚ{˓Ŏźɶ˭ȬǬǬǬǬǬǬǬǬǬǬǬǬ6 D5NFSSWa[n^zadfhݬjէp͞xƘƳʯ̨ɦȦȦȦȦȦȦȦȦȦȦȦȦ6 D5NFRSW`[m_ybegi۴iѫoɣv~ƭʩ̢ʡȡȡȡȡȡȡȡȡȡȡȡȡ6 D5NFRSW_\l_wcfh߻jַfͯmħt|ƨʣ͝˜ɜɜɜɜɜɜɜɜɜɜɜɜ7 D5MFRRW^\j`vdgkhһdɳkrzŢʝ̘˘ɘɘɘɘɘɘɘɘɘɘɘɘ7 D5MEQQW^\iate}jo^οbŸipxŜɗ˓˓ɓɓɓɓɓɓɓɓɓɓɓɓ7 D5LEQQX\]gbqgyn~lZagnv~ÖǑʎɎɎɎɎɎɎɎɎɎɎɎɎɎ7 D5LDRPX[^ednksou_X^els|ŋljljljljljljljljljljljljljlj7 D5KCRNYY`bghnkhqSV\biqyÃđ…ǨĄĄĄĄĄĄĄĄĄĄĄĄĄĄ7 D5KBSLZUb]m`jbUvPOU}ICC_PROFILE]emv΀̍˞˵˽˽˽˽˽˽˽˽˽˽˽˽˽7 D5K@TI\QgUkSVgQ{MLPZdmu~ψΕ~ͦ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ}ͬ7 D5L>UE_IjHUVSmNLNT]emt{҃|эzКyОyОyОyОyОyОyОyОyОyОyОyОyО7 C3M:W>e=ZCU\OqLMPW_fms~x{yՆwԐvԓvԓvԓvԓvԓvԓvԓvԓvԓvԓvԓvԓvԓ8 C/N3[2`.UJOaKsLNSY`gl|qzvx{uځsوsيsيsيsيsيsيsيsيsيsيsيsيsي8D)Q(aR5ONKcJsMQU[a|fykwousswq{pށoރoރoރoރoރoރoރoރoރoރoރoރoރ9ERJ!M;JQIbKpNzRW|\xauesiqmppnsmwk{k}k}k}k}k}k}k}k}k}k}k}k}k}9D:F&G>FPH_KjOrTyzX}u]q`odmhljkmiphsgvfwfwfwfwfwfwfwfwfwfwfwfwfw5 &9A*B=DMHYLbPixUnsYrn]ulawjdxhfyghzfk{em|do}br~bs~bs~bs~bs~bs~bs~bs~bs~bs~bs~bs~bs~bs~"6<*>:BGGQ}LYvQ_pUclYfi]hf`jeckcelbgmahn`jo_lo^np^op^op^op^op^op^op^op^op^op^op^op^op^op1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RMWZ[g_tcglry|xurpnlòkͳmѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴnѴ1@,M?RLVY[g^sbfjpvzwtqonŴmεoеpеpеpеpеpеpеpеpеpеpеpеpе1@,L?QLVYZf]ra~dhlr{zwusq¶qθqθrηrηrηrηrηrηrηrηrηrηrηrη1@,L?PKUXYe]q`|cgkpwჁ{xvts̻tͺt͹t͹t͹t͹t͹t͹t͹t͹t͹t͹t͹t͹1@,K>PKTWYd]p`{cfimuۈ~Ճ{xwv˽v̼w̻w̻w̻w̻w̻w̻w̻w̻w̻w̻w̻w̻1?,K>OJTVYc]o`zcehkܔsՎ{ψʃ|zzǿy˾z̼z̼z̼z̼z̼z̼z̼z̼z̼z̼z̼z̼1?-J>OJTVYb]m`xcegߠjٚrђyʌĆ~}|ʿ|˽|˽|˽|˽|˽|˽|˽|˽|˽|˽|˽|˽1?-J=OITUYa]l`wcegܦiԟp͖wƏ˾˾˾˾˾˾˾˾˾˾˾˾1?-I=NITTY`]k`uc~egګhТnɚu“}£ʾʾʾʾʾʾʾʾʾʾʾʾ1?-I=NHTTZ_^jasc|f޵g֯fͦmŞs{Ýʿʿʿʿʿʿʿʿʿʿʿʿ1?-IWTShOxMQX_go}xzւvՍtԝsӲròròròròròròròròròròròrò2>+H2Q7\7f1UDSZOmM|NQV^g~nzvw}tنrؑp֡o֭o֭o֭o֭o֭o֭o֭o֭o֭o֭o֭o֭2>(H-S.a)R3SKO_LpL}NSY`}gznwttzr܀p܉nۓlڜlڜlڜlڜlڜlڜlڜlڜlڜlڜlڜlڜ2>$I%U O P9NPLbJpM{QV[|axgulsqqvo{mkߊjߐjߐjߐjߐjߐjߐjߐjߐjߐjߐjߐjߐ3>IPJ'L?JRIbKnNxSXz\uasfpknomskwi|h傔g䆕g䆕g䆕g䆕g䆕g䆕g䆕g䆕g䆕g䆕g䆕g䆕2=A?G,GAGRH`LjPr~TwxY|s]pamfkijmhpgsewd{cccccccccccc0 0)=B/CAEOH[Mc}QivVnqZrm^tkbviexghyejzdm{cp|bs}`v~_y~_y~_y~_y~_y~_y~_y~_y~_y~_y~_y~_y~ , 9=/?>DJIS{MZtR`oVckZfh^ifajddlbfmahm`jn_mo^op\rq[tq[tq[tq[tq[tq[tq[tq[tq[tq[tq[tq[tq * 38,<8BByHJrMPlRThVXdZZb]\``]_b^]d_\f`[haZjaYlbXncWpcWpcWpcWpcWpcWpcWpcWpcWpcWpcWpcWpc,;%J6OCTPY\^hcsg}m~sx{tpmjhedbͦcҦd֧fاfاfاfاfاfاfاfاfاfاfا,;%J6OCTPY\^hcsg}m~sx{tpmjhedbͦcҦd֧fاfاfاfاfاfاfاfاfاfاfا,;%J6OCTPY\^hcsg}m~sx{tpmjhedbͦcҦd֧fاfاfاfاfاfاfاfاfاfاfا,;%J6OCTPY\^hcsg}m~sx{tpmjhedbͦcҦd֧fاfاfاfاfاfاfاfاfاfاfا,;%J6OCTPY\^hcsg}m~sx{tpmjhedbͦcҦd֧fاfاfاfاfاfاfاfاfاfاfا,;%J6OCTPY\^hcsg}m~sx{tpmjhedbͦcҦd֧fاfاfاfاfاfاfاfاfاfاfا,;%J6OCTPY\^hbsg}lryzuqnkhfdcͦcҧeרgبgبgبgبgبgبgبgبgبgبgب,;%I6NCSOX[\g`re|io~uytqnkige˩fԪh֪j֫j֫j֫j֫j֫j֫j֫j֫j֫j֫j֫,;%H6MBRNWZ\f`qd{hms~{yuqnljhʬiխkխlԭlԭlԭlԭlԭlԭlԭlԭlԭlԭlԭ,;%G6LARMWY[d_oczgkpx}xtqnmlŮlӯnӯoӰoӰoӰoӰoӰoӰoӰoӰoӰoӰoӰ,;%G5LAQLWX[c_nbxfjnv݂~|xtqoonұpұqұqұqұqұqұqұqұqұqұqұqұ,;%F5K@QLWW[b_mbwehl݌t؆|Ҁ{wtrqqϳrѳsҲsҲsҲsҲsҲsҲsҲsҲsҲsҲsҲ,;%F5K@QKWV[a_kaud~gߘkڒrҊz̈́zwutt˵uдvѳvѳvѳvѳvѳvѳvѳvѳvѳvѳvѳ,;%E4K?QJWU[__iasd{fݞjՖqΎwȇ‚~{ywwȶxеxѴxѴxѴxѴxѴxѴxѴxѴxѴxѴxѴ,;%E4K?QIWT[^_gapcye٣iњoʒuË|~|{{ŷ{϶{д{д{д{д{д{д{д{д{д{д{д,;%D4K>QHWS[\_eancuޮe|էg͝mƕsz¸~Ϸ~е~е~е~е~е~е~е~е~е~е~е,:%D3K>RHWQ\Z_cbkdq۳a{Ҫeʡk™rxθϵϵϵϵϵϵϵϵϵϵϵ,:%C3K=RGWP\X_`bgߺelط^zήdƥjpv}θ϶϶϶϶϶϶϶϶϶϶϶,:%C2KC2EBFPIZMb{RhtVmoZpl^sicuggwejxcnyaqz`t{^x}]~~[[[[[[[[[[[ 1;!?2A@DKITyNZrS_mWci[ff_hdbjbek`hl_km^nn\po[tpYxqX{rX{rX{rX{rX{rX{rX{rX{rX{rX{rX{rվ.6!;/>;DDwIKpNPkSUfWXc[Za^\_a]]d_\f`[iaYkaXmbWpcVsdUveUveUveUveUveUveUveUveUveUveUve)16*};3tB;mHAhMEcRI`VK^ZM[]OZ_PXbQWdRVfSThSTjTRlUQoVPqVPqVPqVPqVPqVPqVPqVPqVPqVPqVPqV|'|7zF.L:RFWQ]\bghp{nxutp~lheb`^][ʗZ֘[ٙ]ݙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ|'|7zF.L:RFWQ]\bghp{nxutp~lheb`^][ʗZ֘[ٙ]ݙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ|'|7zF.L:RFWQ]\bghp{nxutp~lheb`^][ʗZ֘[ٙ]ݙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ|'|7zF.L:RFWQ]\bghp{nxutp~lheb`^][ʗZ֘[ٙ]ݙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ|'|7zF.L:RFWQ]\bghp{nxutp~lheb`^][ʗZ֘[ٙ]ݙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ_ߙ}'}7{F.K:QEVQ\\afgp}lxwsr|njgdb`^]ə[՚]ښ^ޛaaaaaaaaaa}'}7}E-J9PEVP[[`feokx|pwxrnkgeca_ǜ^Ӝ_ܝbߝcޝcޝcޝcޝcޝcޝcޝcޝcޝcޝ~'~7D-I9ODUOZZ_ddniwn{uv~rnkhecbŞaҟbݟdݠeݠeݠeݠeݠeݠeݠeݠeݠeݠeݠ'7C-H8OCUNZY^ccmgvl~s{{vqnjhfd¡dСeܡgۢhۣhۣhۣhۣhۣhۣhۣhۣhۣhۣ'7B,G7OBTMYX^bblfuk}qxzupmjhgg̤gۤiڤjڤjڤjڤjڤjڤjڤjڤjڤjڤjڤ'7A,G7NATLYV]`ajesi|o߃v~~xtpmkjiȦj٦k٦l٦l٦l٦l٦l٦l٦l٦l٦l٦l٦'6A,G6N@TKYU]^`hdqgzmۉtՂ{|wspnmlŨlרnبoبoبoبoبoبoبoبoبoبoب'6@+G6N?TIYS]]`fcofwݔl֍rІyʀ{wtqpooӪqתrשrשrשrשrשrשrשrשrשrש'6?+G5N>THYQ\Z_cblߠdtٚj}ёpˊwƃ}~zwusssЫt֫t֪t֪t֪t֪t֪t֪t֪t֪t֪t֪'6?+G4N=TGXO\X_`ahݦdpԞh}ΕnǍt{~{xwvvͭwլw֫w֫w֫w֫w֫w֫w֫w֫w֫w֫'6>*G3N*G3N;TCXK\S_Y޴a_֮_nΥe|Ɲkqw}~~~Ȯ~ԭ~լ~լ~լ~լ~լ~լ~լ~լ~լ~լ'6>)F2N:TBXI\O_Tܹ\]ұ^nʩc{áiou{ƮԮլլլլլլլլլլ'6>)F1N8T?YF]K`NؽW]ϵ\mǭbzgmryîԮխխխխխխխխխխ'6>(F0M7T=YB]E^IU\˹[lò`zekpv}ԭլլլլլլլլլլ'6>'F.M4T9Y=_>SHSZǾYk^xcint{~{{լ}ի}ի}ի}ի}ի}ի}ի}ի}ի}ի'5=&F,M1T5Z6a3KFRYWi\waflrx{xut֪w֪w֪w֪w֪w֪w֪w֪w֪w֪w֪'4=$F)M-T.[,R0JEPWUgZu_diov~yurpnاp٧p٧p٧p٧p٧p٧p٧p٧p٧p٧'4="E&M'T%\J.JBNUSeWr\}agm~tx{solkiբjۣjۣjۣjۣjۣjۣjۣjۣjۣjۣ'3<E LSJO.PAORQbUoZz_d~kxrrzn̓jΏhϟfдdӜeߝeߝeߝeߝeߝeߝeߝeߝeߝeߝ'2<CJ>I"M5NHMWNePpUx[|avhqolwh߀ebᚕ`⭖^Ȗ_ޖ_ޖ_ޖ_ޖ_ޖ_ޖ_ޖ_ޖ_ޖ_ޖ'1:?;@H(K;KLLZNeQoUvzZ{s_nejlftd|aꅌ`鏍^蛏\譐[辐[辐[辐[辐[辐[辐[辐[辐[辐[辐'/5 ./@F.H?JNKZNdQkyUqsZum_yje|gk~dqbw_~^\펆Z횇Y즈Y즈Y즈Y즈Y즈Y즈Y즈Y즈Y즈Y즈$ )!3 ? C2FAHMKWN_xRerVjm[ni`qfescjuanw_sx]xy[}{Z|X}V~V~V~V~V~V~V~V~V~V~3<#@3D@GJ~JRvNYpS^kWag\dd`gbdi`hj]ll\pmZtnXxoW|pUqTrTrTrTrTrTrTrTrTrTr۱!18#=1A;|EDtJKnOPiSTeXWb\Z``\]c][f^Zi`XlaVpbUscTwdR{eQeQeQeQeQeQeQeQeQeQeκ -4!:,z>5rC$D.K8RCXM]Vb`gilq{sxv{~rmjgdba`ʕ`ڕabcccccccccv" w3}=$C.K7QAWK\Ua^egjoqw{y~vqmigeccƘb՘cᘾeᙻfᙻfᙻfᙻfᙻfᙻfᙻfᙻfᙻfw" w3~<#C-J6Q@VI[S_\dehnov݀v}z}upmjhfešeћfghhhhhhhhhw" x3;#C,J5P>VGZQ^Zbcfk݋ms؅t|~{xtpmkihh͝iߝjߝkߜkߜkߜkߜkߜkߜkߜkߜkߜx" x2:"B+J4P=UFZN]Wa_ߗehِkq҉r{͂x|xtqnmlkʟlݟmޞnޞnޞnޞnޞnޞnޞnޞnޞnޞx" y2:"B*J3P;UCYL]T`\ܝddԔiqΌp{ȆvÀ|{wtrpooǠo۠pݟqݟqݟqݟqݟqݟqݟqݟqݟqݟy" y2:!B*I2O9TAYI\Pߦ^XءacИhpʐn{Ċtz{xutsrġsءtݠtݠtݠtݠtݠtݠtݠtݠtݠtݠy" z29!B)I0O8T?XF[Lݬ]Sԥ`c͜fpƔl{rx~|ywvvwԢwܡwݠwݠwݠwݠwݠwݠwݠwݠwݠz" z29 A(I/O6T޶ZBִVQά]aƤcnhynsyУܢ~ܡ~ܡ~ܡ~ܡ~ܡ~ܡ~ܡ~ܡ~ܡ{" |19A&H,N1S5W9ܼU?ҷUQʰ\`¨angylqw~Σۢܡܡܡܡܡܡܡܡܡ{" ~08A$H)N.R1V2M>ϻTOǴZ_`mexjou{}ˣ~ܢܡܡܡܡܡܡܡܡܡ|" /8@"G'M)R+V)J<˿RNùX^^kcwhmsy{ywȢxܡyݠyݠyݠyݠyݠyݠyݠyݠyݠ}! /8@ F#L$Q"H'I:QLW\\jauf~kpv}}xurqƠqݟsݟsݟsݟsݟsݟsݟsݟsݟsݟ~! .7?EJN=%G8OJUZZg^sc|hnt}{wsomkÝjߜlߜlߜlߜlߜlߜlߜlߜlߜlߜ! -6>CG=;"E6MHRWWe\payfl|rvyqmjgfdfffffffff! ,5;?<9 C F3KDPTUaZk^td{{iuppwkhȊeȘbɩa``````````! +27 3'=F$J5LENSR^Wh\pzavtg{onjuf~cڈ`ۖ^ܦ\ݼ[ۊ\\\\\\\\\! ( -*.>E*H:KHNTQ^UfxYlr_qmeuhkxdr{az}^[ꏁX뜂V쯃UȃT݄T݄T݄T݄T݄T݄T݄T݄T݄#2 >C.G=JIMSQ[wUaqYfk^jgdmcip_or\vtY~vWxUySzR{Q|Q|Q|Q|Q|Q|Q|Q|Q| 3<"B1F=IG~MOvQVoU[iY_e^babe^gg[liYrjWxlU~mSoQpOqNrNrNrNrNrNrNrNrNrҷ$2:#@0D:{HCtLImPOgTScYV`]X]bZZf\Xj^Vn_TsaRxbP}cNdMeKfKfKfKfKfKfKfKfKfӯ $ 07"=,yB5qG#F,M4S=XF]ObWg`ށoh|vov}vq|mjgedcbʎbۏc珵d珳e珳e珳e珳e珳e珳e珳e珳eo! n/{5>"E*L2R;WC[L`Tߍf]ڇmeӀtozzwu}qnkigfeǑeؑf摮g摭h搭h搭h搭h搭h搭h搭h搭hp! o/}5=!E)K1Q8V@ZH^QۓdYԋke΄qo~wwy~~uqnljiiÓiӓi哧j咦k咦k咦k咦k咦k咦k咦k咦kp p.5= D(K/P6U=XEޝ\LחbXЏieʈoołuw}{~yurpnmllЕm䔡n䓠n䓠n䓠n䓠n䓠n䓠n䓠n䓠nq r-4<D&J-O3S:W@ۣZIӛ`X̓gdƌmnswy~}yvsrpppΖp╚q䔚q䔚q䔚q䔚q䔚q䔚q䔚q䔚qq s,4<C%I*N0R6ߩV<اWHП_Wɗecknqww~|}zwuttt˗tt㕔t㕔t㕔t㕔t㕔t㕔t㕔t㕔tr u+3<C#H(M-Q2ݯT6ԪVG̢]Vśccimovu~z~{yxxxɘxޗx㖎x㕎x㕎x㕎x㕎x㕎x㕎x㕎xr v*3;B!H&L*P-ڴM5ѭTFɦ\UŸbbhmmvr}x~~}||Ƙ}ݘ|㖈|㖈|㖈|㖈|㖈|㖈|㖈|㖈|s x*3:AG#K%߶N'ַJ4αSEƪZT`aflkup}v|Ęۘ▂㖂㖂㖂㖂㖂㖂㖂s z)2:@EI ݼK ӻI3ʵRD¯YS_`dkitn|tz}{zؗ{||||||||t |)19?DF>ϿG1ƺPBWQ]^bigsl{qw~}yvtsՖuvvvvvvvvu(08=AB:F/¿N@UO[]`heqjyou{|wspnmҕnoooooooou' /6:< 3 8D-L>SMYZ^ecnhvm|r{yuqmjhgБghhhhhhhhw& - 3 5 0'6B*J;QJWW\b`kerjyzp~tvo~kgdca΍abbbbbbbbx$ + .) #3?'H8OFTSY^^fcmyhssnxnu|j|fÆbÒ_â^ĵ\͆[\\\\\\\\|!%"):C#H3MBRNWX\`yagsglmmqisue{xa҄z^ӑ|[Ԡ}Zմ~X~X~WWWWWWWW/ <C)H7LCPM}TVvY\p_bkdfgjjcqm_xo\rYtWuUvSvRvRvRvRvRvRvRvRvRvֵ2<B,G9LC|PKuTRoXWi][ec_ahb^ndZugW|iTjRlPmNnLoKoKoKoKoKoKoKoKo ׫̼$3;!A-F7{K@sOFmTLhXPc]S`bV\fYYk[Vq]Sw^P`MaJcHdGeFeFeFeFeFeFeFeFeڣ͵& 29!@+xE3qJ:kN@eSDaWG]\JZ`LVdNShPQmRNsSKyTIVGWEXDYDYDYDYDYDYDYDYDYέľ$ /~7u=&nC-hH3bM7]Q:ZV=VZ?S]APaCMeDKiEInGGsHFxID}JBK@L@M@M@M@M@M@M@M@MŸ z+r3k:d@%^E)YJ,UO/RS1OV3LZ5I]6Ha7Fe8Di:Bm;Aqz=<>;?;?;?;?;?;?;?;?vm$ f-_4Y;T@PE!MJ#IN%FR&DU'BX)@\*>_*=c+sG(uO2uW;r^CnfKimRewXb]^a[dXgViUkSlRnPoPoOpNpNpOpQqQqQqQqQqQqQqQqc$ _/ f7p=vF'xN1xU:v]CrdKmkRitXe}^ab^f[hYkWmVnTpSqRrQrQrQrQsStStStStStStStStc$ `/ i5s=yE'|M0|T9z[BwbJriRmqXiz^ecbg_j\mZoXqWrVsUtTtTtTuTvUwUwUwUwUwUwUwUwd$ `. l3v<|D&K.R7~Y@{`IwgQrnXnw^icfhbl`o]q[sZuXvWwWwWxVyWzXzXzXzXzXzXzXzXze# a. n2y;C$J-Q5W>^G|dOwkWrt^n{djifmcp`s^v\x[yZ{Y{Z{Y|Z}[}[}[}[}[}[}[}[}f# c- q1|:B#I+P3V<\EbM}iUxq\sxcnijngrdvby`{^}]~\\\]^^^^^^^^f" e+ t1~9A!H)N1T9ZB_J߂gS}oZxucs|jnokthxe{c}a``Ă_ӂ`ザ`bbbbbbbbg" g* v08@ G'M.R6W>]GۉeOՂlZ|scwyjrpoukyi}gedccυcᅯd텫e턫e턫e턫e턫e턫e턫e턫eg" i( x/8?E%K,P3U:ݓZB֍bNІiYˀpc{vkv|qsvozm~jhgfḟgއg쇤h솤h솤h솤h솤h솤h솤h솤hh" k' z/7>D#J)O/S6ژX@ґ`M̊gYƄnbtjzzqvws{pnlkjjɉj܉k눝l쇝l쇝l쇝l쇝l쇝l쇝l쇝li! m& |.6=C H&M+ݡQ1՜V?Ε^LȎeXˆlbrj~xqz}ww|trpnnmNJnيnꉖo눖o눖o눖o눖o눖o눖o눖oi! n% }-5<BG"K'ۦM.ҠU>˙]LŒdWjapjuq~{w{|xvtrqqċq֋r銐rꉐrꉐrꉐrꉐrꉐrꉐrꉐrj! p% -5;AEߩH"تJ-ϣS=ȝ[KbWhanispyv{|zxvvuvԌv苊vꊊvꊊvꊊvꊊvꊊvꊊvꊊvj r$ ,4:?CݮEԭH,̧R;šZJ`Vf`liqpwv|{~|{zzzҌz狄zꊄzꊄzꊄzꊄzꊄzꊄzꊄzk t$ + 39=@۴?ѰG*ɫP:XI_Ue_jhoouvz{}ύ}~~~~~~~~~~~~~~~~k v# * 17:<ָ9ʹE)ůO9VG]Tc^hgmosuxz~~{xw͌wxyyyyyyylx") 0 4 7 ݸ6 Ҽ8ʸD'M7UF[Ra]ffkmptvy|~{wtrqˋqrrrrrrrrm{!( - 1 0'6ƽB%K5SDYP_[ddiknrswy|zuqnljȉjlllllllln~ %*+޻$#3@#I3QAWN]Xbagilo~qtywyt~}okhfdƆd߆eeeeeeeeq"$ 1= G0O>UJ[U`]ee~jkxopsuun|yi|fc`_Ă^݁^^^^^^^^vּ- :D,L:SFXP]Y}b`whfrmkmsohzsdv`x]z[{Z{YzX|X|X|X|X|X|X|X||ֳ* 8B'J5PAVK}[SvaYqf_lkcgrgcyk_́m\͌pY͚qWάrVrUrTsSsSsSsSsSsSsSsةθ/ ;B&H3N={TFuYMo_RjdWfj[bp_^wa[dXފfUߗhSiRiQiQhQiQiQiQiQiQiQi ۠ϰƿ"2;B)H3zN;sRBlWHg\LcbP`hS\mVYtYV{[S]P_N`LaKaJbJbJbJbJbJbJbJbѩǸ&2;B(xH0qM7kR=eVAa\E^`HZeJWkMTpOQwQN~SKTIUGWEWDXDXDXDXDXDXDXDXӡȲ& 1|9u@%nF+hL1cP5^U9[ZTc@QgBOlDLrFIxGFIDJBK@L>M>M>M>M>M>M>M>Mʬ$ y/q7j>dD$_I)ZN,WS/SW1P[3N_5Kc7Hh8Fl9Cr;Ax<>~=<>:?8@8@8@8@8@8@8@8@~t!l* f2`:Z@VERJ"NO$KS&HW'F[)D^*Ab+?f,=k.:p/8u06{1421313131313131313{qha% Z- T3O:K?HEEIBM?P=T;X9[7_4c 2h!0l".q",v#*|$*|$*|$*|$*|$*|$*|$*|$V( Q3 R9[?aG cQ)bY2^b9[l@WvETIPMMPKRJTHUGVFWEXDYDZCZBZBZBZBZBZBZBZBZBZBZBZV( Q3 T8]>bG dP)cY2`a9]k@YuEU~JRNOQMSKUJVIWHXGYFZE[D[D[C[C[C[D[D[D[D[D[D[D[W( R2 V7`=eF hO)gW1d`9`i@\rFY|KUORRPTNVMXKYJZI[H\G]G]F]F]F]F]G]G]G]G]G]G]G]X' S2 Y5b<hE kM)jV1g^9cf@`pF\yKXOUSSVQXOYN[M\K]J^J^I_H_H_H_I_I`I`I`I`I`I`I`X' T1 [3e;lCnL(nT0k\9gd@cnF_wL\PYTVWTYR[Q]O^N_M`LaLaKaKaLaKbKcKcKcKcKcKcKcY& U1 ^1i9oBrK'rS0oZ8lb?gjFctL`|Q\UZXW[U]T_R`QaPbOcOcNcOcNdMfNfNfNfNfNfNfNfZ& W0 b/l8sAuI&vQ.tX7q`?lhFhqLdyQaV^Z[]Y_WaUcTdSeRfRfRfQgQhPiQjQjQjQjQjQjQj[& Y. e.p7v?yG%zO-yV5v^=qeEmmLivRe~Wb[_^\aZcYeWgVhUiTjTjTkTlSmTmTmTmTmTmTmTm\% \, h- s6z>}F#~M+}T3{[;wbCrjJnsQj{Wf\c``c^f\hZjYlXmWnWnWoWpWpXpXpXpXpXpXpXp]% _* k, v4}=D!K(R0X9|_AxhItpPowVk~]gadebi_k^n\o[qZrZrZsZsZs[s[s[s[s[s[s[s]$ a( n+ y3;BI&O-U5\>~eFymOstWo{]kchgekcnap`r^t^u]v]v^v^v_v_v_v_v_v_v_v^$ d& p* |2:@G#M*R2݈Z:փbD}jOxqWsx^p~dlhilgpercubwaxayayaxbxcxcxcxcxcxcxcx_# f% s) ~18?E J&ߑO-ٍW7ч`D́hN|oWxu^t{dpimmkqitgwfyezd{d{e{fzfyfyfyfyfyfyfy_# h# u( 07=BG"ܗL(ԒU6͋^CȅeN€lW|s^xxdt~jqnormukxizh|h}h}i|i{j{j{j{j{j{j{j{`# j# w' / 5;@DٛI&ЕS5ʏ\BĉcMjVp^|vdx|junsrpvnym{l}l~l~l~m}m|m|m|m|m|m|m|`"l" y& . 49>ޠA՟G%͙R4ǓZAbLhVn]td|yjynwstvrzq|p~oopq~q}q}q}q}q}q}q}a"m!z%, 2 7;ۦ=ҢF$ʝP3×Y@`KfUl]rdwi}}n{sxwvzu}tss̀tt~t}t}t}t}t}t}t}a"o!|$+ 0 4 7ة8ϦD#ǠN2W?^JeTj\pcui{ns}w{zy}xxxʁxހyx~x~x~x~x~x~x~b"q #). 1 ު2 ԭ6̩C!ĥM0U>]IcSi[ncsiynswz~}}|}{}ȁz}܀z}{|~{|~{|~{|~{|~{|~{|~d s"'+,ۯ*Ѱ4ȭA K/T<[HaRgZlbqhwm|rvz|}yvuŀtڀtu~u~u~u~u~u~u~fv!$&%ֵ"ʹ2IJ?I-R:YF_PeYj`oftlzq~uzyv|r~poÀnn~o}o}o}o}o}o}o}iy ݱҸɹ0 =H+P8WD]NcWh^mdrj}xox~stwpzl|j}h~h}h}i|i|i|i|i|i|i|l|շͽľ. ;E(N6UA[LaTf[kb|pgwulr|pntjwgydzb{azazbzbzbzbzbzbzbzp կλ+ 8C%L2S>YH^PdX{i^vncqsgmzkhodrat_u]v\u[v[v[v[v[v[v[v[vu קδ'5@!I.P:WC\L{bRugXpl]krbgxeci_k\nZoXoWoVoUpUpUpUpUpUpUp{ ڞЬȹ "2=F)N4T>zZEt`LoeQjjVfpZbw^^a[ȈcXȕeUȥfTɹgSfRfQhQhQhQhQhQhQh ҥɳ/ ;D#L.yS6sX>n^DicIeiMaoQ]vTZ~WW؇YTٔZR٤\Qڷ\P\P[N]N]N]N]N]N]N]՝ʬ #2<}C$vJ,pP3jV9f[>baB^gE[lHXsKUzMROOQMSKSJTITHTHTHTHTHTHTHTڕ̦µ&2{;tC"mI)hO.cT3_Z7[_:Xd=Ui?RoAOvCM}EJGHHFJDJCKBKBKBKBKBKBKBKΠð~'w1p:jAdG#_M'[R+XW.U\0Ra3Of5Lk7Jp8Gw:D>?=@;A;A;A;A;A;A;Aū {s%l. f7`>[DWJSO"PT$MX&J](Ha)Ef+Ck,@p.>w/;~192736454545454545454w og"a+ [2 U9Q?MEJJGNDSBW?[=_;d 9i!6n"4t#1{$/%-&,',',',',',','tkc\U&O- J3 F9C>?CK>K=K=K=K=K=K=K=K=K=K=KL* G5 M7 S:ZD\M [W(Y`/Vj5Rt:O~>LAJDHFFGEIDJCJBKBLALAM@M@M@M@M}ICC_PROFILE@L@L@L@L@L@L@LM* G5 O5 V9]C_L _U(\^/Yh5Ur:R{?OBLEJGIIHJGKFLEMDNCNCNBOBOBNBNBOBOBOBOBOBOBON* H4 R3 Z8`AcK bT'_]/\f5Yp;Uy?RCOFMHLJJLIMHNGOGOFPFPEPEPEPEPDQDRDRDRDRDRDRN) K2 U1 ]6d@fIfR'd[.`c5]m;Yv@VDSGQJOLNMMOKPJQJRIRIRHSHRHRHTGUGUGUGUGUGUGUO) O0 X. a5h>kGkP&iX.e`5aj;^s@Z|EXHUKSNQOPQORNSMTLULULULUKVJXJYJYJYJYJYJYJYP( R- \- e3l<oEoM%nV,j^4ff:bp@_xE\IYMWOURTSRUQVQWPWOWOXOYNZM\M\M]M]M]M]M]M]Q(U+ `+ i2 p;sCtK#sS+p[2kc9hl@duEa}J^N\QYTXVVWUYSZS\R\R]R]Q_Q_Q`Q`Q`Q`Q`Q`Q`R'X) c* m0 t9xAyH!xP(uW0q_8mi?jqEfyJcO`S]V[YY[X]W_V`UaUaUbUcTcTcUdUdUdUdUdUdS'[& g) p. w7|>}F}M&{T-w\5sf=onDkvKg}QdUaY_\]^\`ZbYdXeXeXfXfXgXgYgYgYgYgYgYgT&^$ j' s- {5<CJ"P*}Y2yb;tkDorLlyRhVfZc^aa_c^e]g\h[i[i\i\i\i]i]i]i]i]i]iU&`"m& v+ ~3:@F߆M&؃V/}`:xhDtoLpvRm|Wj\g_eccebh`j`k_l_l_l`l`k`k`k`k`k`k`kU&c!o%y*1 7=CیJ!ӇT.͂]:}eCxlLtsRqyXn]laidggfjdlcmcncococndmdmdmdmdmdmdmW%e q${(/ 4:ߒ?֐G ϋR-Ɇ[9ÁcC|jKxpRuvXr|]pamekhikhmgofpfqgpgphohohohohohohoX#gs#~'- 2 6ܗ:ӔȄP,ŊY8aBhK|nRytXvz]sbqeoimllokqjrjrjrkqkpkpkpkpkpkpkpZ"iv"%*/ 2 ٛ7ϗCȒN+ŽW7_AfJlQ}rXzx]w}aufsiqmpoornsnsnsoroqoqoqoqoqoqoq\ kx!$(+ޜ.՞5̛BŖL*U6]@dIjQpW~u]{{ayfwjumtpsrrtrtrtrssrsqsqsqsqsqsq^mz "%'ܠ'ѡ3 ɞ@šK(T5[?bIhPnWs\ya}f{jymxpwsvtvu~vu~vs~wr~wr~wr~wr~wr~wr~wr`o| !!إ!Υ1 Ƣ>I'R3Z>`HfOlVq\wa}ej~m}p}|sz{ty{ux{ux{tx{rx{rx{rx{rx{rx{rx{rbq~ߡԨ˨/ æ<G%P2X=_FeNjUp[u`{ei~mzpwrttsurtrsrrrrrrrrrrrrrrdt٦ЬǬ- ;E$N0V;]EcMhTmZs_xd}hxltoqqnsmtlslslrlqlqlqlqlqlqgw۟Ӫ˰±+8C!M.T9[BaKfRkXq]{vbw|fsjomkohqgrfreqfpfpfpfpfpfpfpk{ԣͮƴ(6AJ+R6Y@_HdOiUznZut_qzcmfijelcnao`n_n_n_n_n_n_n_n_no ֛ΧDz$3>H(P3W<]DbKygQtlVprZkx^gbce`h]i[jZjZjYjYjYjYjYjYjYjt ۓСȭ / ;E$M.T7~Z?x`FseKnkPjpUfvXb~\^_[aXcVcUcUcTdSdSdSdSdSdSdz әʧ+ 8BK)}R1wX9r^?mcDhiIdoMauQ]|TYÅWVÐYTßZRñ[Q[QZO\O\O\O\O\O\O\̡ؒî&4?{H"uO*pV1k\7gbA>@?@?@?@?@?@?@?ɞ xq(k2 e:`B[HWNTT!QY#O^&Lc(Ii*Go+Du-B}/?0=2<3:494949494949494|t mf&`/ [7 V>RDOJLOITFYD^Bc?h =n":u#8|$5&4'2(1(1)1)1)1)1)1)|ph b[#U+P2 L9 H>EDBH?M9=:=;<;;<;<:=:=:=9=9=9=9<9<9<9<9<9<96 E5 K9 PASKRUP_$Mj*Jt.G}2E5C7B9A:@;?<>=>==><><><>;>;><><=;>;>;>;>;>;>B-@4 H4 N7 S@VJUSS]%Qh*Nr/K{3H6F8E:C;B@????@?@>@>@>@>?>@=A=A=A=A=A=AC-C2 K1 R6 W>ZHZQW[%Ue+Ro/Ox4L7J9H;G=F>E?D@CACABBBBABABAAABAC@D@D@D@D@D@DD,F0 O/ V4 [<_F^O\X%Yb+Vl0Su4P~8N;L=K?I@HAGBGCFDFDEDEDEDEDDFCGCHCHCHCHCHCHE,I- R, [2 `:cCcLbU$^^*[h0Xr5Uz9SnGlO!iX(fa/cj5`s:]{>ZAXDVGTISKRLQMPNOOOPOPOQNSNSNTNTNTNTNTNTH*T%_'h, m3 q;sCrKoT&l]-hg4eo9bw?_C\GZJXLWNVPURTSSTRURURVRWRWRWRWRWRWRWRWK(W"c%k+q0 v8x@wHuP#rZ*nc2jl:gs@dzEaI_L]O[RZTXUWWWXVYVYVZVZVZVZVZVZVZVZVZM&Z f$o)u. z5 |<}D{LxV(s`2oh:kpAhwFe}KcNaQ_T^V\Y[ZZ\Z]Y]Z]Z]Z]Z]Z]Z]Z]Z]Z]P$]i#r'y,~2 8?ځI|S'x]1te:pmAmsGjzLgPeScVbY`[_]^_]`]`]`^`^`^_^_^_^_^_^_R"`l!u%|).4 ݇:ՅE΁P&|Z0xb9tjAqpGnwLl}PiTgWfZd]c_baabacacabbbbabababababaT bn w#'+0 ڌ7 щCʅN%ĀX/|`9xg@unGrtLpzQmUkXj[h^gaecedeeeeedfcfcfcfcfcfcfcVdpz"$'ߎ+Ր4 ͌ALjL#V.^8|e@ylGvrLtwQq}UoYm\l_jbidifhfhfifiejdjdjdjdjdjdXfr| !#ܒ%ғ2 ʐ?ÌJ"T-\7c?}iFzoLwuQu{UsYq]p`ncmelglglhmgmfmemememememeZhtٖ ϖ0 Ǔ=H!R,Z6a>hE~mK{sPyyUwYu]t`rcqfpgphphpgqfqeqeqeqeqeqe\kwԙ̙.ė<G P+X5_>fElKqP}wU{}Yy]xavduf~th|ti{ti{th{ug{uf{uf{uf{uf{uf{uf^myݗ ќȜ,:EN*V4^GyO&sU-o\3ja8fg=bm@_sD[zGXJUMRNPOOOOONPMQMQMQMQMQMQҏǝ.}:wCqLlS&hY+d_0`e4]k7Yq;Vx>Ś@P̋BN̙DL̪EKͽEJEJEIGIGIGIGIGIG؈ʗ}y)s6 n@iIePaW"]]&Zc*Wi-To0Qv3O5L܉7Jݖ8Hݦ9G޹:F:F9E;E;E;E;E;E;Β¡ytn)i4 d=_E[LXRUYR_"Pe%Mk'Kr)Hy+F-D/B0@1?2>2=2=2=2=2=2=2ŝxo je)`3 [; WBSHPOMTKZH`FeClAs!>{#<$:&8'7(6(5(5(5(5(5(5(wke`Z'U0Q7 M> JD GIDOAT?Y=^;d8k6r3z1/.-,,,,,,wj`Z UO#K+F2B8?= *B(G %K "P V \ b j q y  6045 ;5 ?8 D@ EJEUD`Ak?u#<~&;(9)8+8,7-6-6.5.5/5/4/4/4/4/4.4.4.4.4.4.4.4.7074>4 B7 G? HIHTG_Di Bs#?|&=)<+;,:-9.9/8/80707070606060607/6061616161618/:2A2 F6 K> LGLQK\Hg Fq$Cz'A*@,>-=.=/<0;1;1:2:2:2:29292:1928384848484849/=0D/ K4 O< QEQOOYMd!Jn%Hw(E+D-B/A0@1@2?3?3>4>4=4=4=4=3=4<5;7;7;7;7;7;7:.@-H, P2 T: VBVLTVR`!Oj%Mt)J|,H/G1F2E3D4C5C5B6B6B6A6A6B6@8@:?;?;?;?;?;?;;.D*M)U0 Z7 \@\IZSW\!Ug&Rp*Oy-M0L2J4I5H6H7G8G8F9F9F9F9E;D=C>C?C?C?C?C?C?>,H'R'Z- _5 a<bF`O]X Zb&Wl*Uu.S}1Q4O6N7M9L:K;JI>H@HAGCGCGDGDGDGDGDA)L$V%^+d2 f9 gBfKcT`^%]h*[q/Xy2V5T8R;Q

O@NAMBMCLCLDLELFLGKGKHKHKHKHKHD'P [#c)h/k6 l>lGiPfZ#cd)`m/]u4[|8Y;W>U@TBSDREQGQHPHPIPIPJPKPKPKPKPKPKPKH$S^"g'l,p2 q: qBoLmW i`)ei0bq5`x:]~>\AZCYEWGVIUKTLTMTMTNTNTNTNTNTNTNTNTNJ!Vb j$p)t/v5 w=uHrS n])je0gm6et;bz?`C^F]H[JZLYNXPXQWQWQXRXRXQXQXQXQXQXQMZen"t&x+{0|8 zDvPsZ(ob0lj7iqkCpGvL~|PzSw~Wt}Yq|\o|]n|]m|]m|\n|[n|[n|[n|[n|[n|[a o {مЍɔš "1 =GO'V/]6cSAQCNDMDLDLDKEKFKFKFKFKF͌™|'w4q>mGhOdV a\$]b(Zh,Wn/Tu2Q}5NLJ7LǓ9Jǣ:HǶ:H:H:F;F VF SMQTN[LaIhGoEvC!@#?$=%<%;%:%:%:%:%:%:%rg` ]X)T3Q;MB JI HOEUC[Aa?hH ;N 9S 7Y 4_2f/n-w+*('&&&&&&sfZRL HD"@*<0965;2@0E-J*O(U %\ #c k t }         tfYMGA<84#0)-.)3&7#; @EJPV^ fnw ~       *2-33356 9? ;I :T9_7j6t4}3210 0 /!/!.!."."."-"-!-!-!- - -!-!-!-!-!+20162:5 => ?G >R=];h9r7{654 3!3!2"2"1#1#1#1#0#0#0#0"0"0#/$/$/$/$/$,1409/>3 B< CE CPB[@e>o;y:9 8!7"6#6$5$5$5%4%4%4%4%4$4$4%3&3'3'3'3'3'.07-=,C2H: IC HLGWEbCl@v?~ ="<#;$;%:%:&9&9'9'9'8'8&8&8'7)7*6+6+6+6+6+2.;*A)I/M7 O@ NILTJ_HiFrDz!B#A%@&@'?(>(>)>)=)=)=)=)=)<+;-;.:/:/:/:/:/6+?&G&O-S5 U= TFRPPZNeLn Jw#H~%G'F(E)D*C*C+C+B+B,B,A,A.@0@2?3?3?3?3?3?3:(C#L$T*Y1[: ZB YKVUT`Rj Os$Nz&L(K*J+I,H.G/G0F1F1E2E2E3D5D6D7D8D8D8D8D8>%GR"Y(^.`6 `> _G]QZ\Xf Un$Sv(Q~+P-N/M1L2L4K5J6J7I7I8I8I:I;HM?M?M@M@M@M@M@M@DOZb"g(j-k4k< iHfSc] `f&^n+\u/Z{3X5W8U:TtIqSn\'ld-ij2gq6ew:d}=b@aC`E_G^I]K]L]L]L]K^K^J^J^J^J^JO\goty||.{; xGuQrY&pa,mh2kn6it:hz>fAeDdFbIaKaM`N`N`NaMaMbLbLbLbLbLQ^iqw| ʀ+9 |EyNvW%t_,qe1ol6mq:lw>j}AiDgGfJeLeNdOdPdPeOeNeMeMeMeMeMSaks y~΁ǃ)7 B}LzU$w\+uc1si6qo:ou>n{AlEkHjKiMhOhPhQhQhPhOiNiNiNiNiNU c m u|ҁ˄Æ'5 AJ~S#{Z*ya0wg5um9ss=ryApEoHnKmNlP~lQ|kR{lR{lQ{lP{lO{lO{lO{lO{lOW e ow~σLJ$3 ?HQ"X)}_/{e5yk9wq=vwAu}EsHrK|qNzpPxpRwoRvpRvpQvpPvpOvpOvpOvpOvpOZ g qzсˆĊ "1<FO!W(]/d4}i9|o=zuAy{E}xHzwKwuNuuPstRqtRptRptQqtPqtOqtOqtOqtOqtO\jt}΄lj .:DM U'\-b3h8m<s@{~yDx}Gu|Kr{NozPmyQlyRkyRkyQkyPkyOkyOkyOkyOkyO_lwҀʇÍ,8 BKS%Z,`1f6}k;zq?vwCs~FoJlLjOhPfQeQePe~Of~Of~Of~Of~Of~Ocoz΃Ƌ)5 @IQ#X)^/|d4xi9to=quAm|DjHgKdMbN`O_O_O_N`N`N`N`N`Nfs~ʇ%2 =FN U'z\,vb1rg6om:ks>hzAdEaG_J\K[LZLYLYLYKYKYKYKYKkwςŌ !/:D~LyS#tY(p_-me2ik6fq9bx=_@\CYEWGUHTGTGSHSHSHSHSHSHp}Ɉ+7 |@wIrPnW#j](gc,ci0`o4]v7Y~:V=T?QAPAOAOANBMBMBMBMBMBvσĎ~&y2t= oFkMgTd["`a%]g)Zm,Wt0T|3Q5N7L9K9J9I9I:H;H;H;H;H;}Ȋx tp-k8gB cJ`Q]XZ^Wd!Tk$Qr'Nz)K,I.G/E/E/D/D0C1C1C1C1C1̅xlhe&a2^=[E XMUTR[OaMhJoHwEπ!Cό"AϚ$@Ь$?$>$>$=&=&=&=&=&ďymcZ WU*S6P?NGKO IV G\EcCjAr>|<;987666666znbXQ NL(I2F:CAAH?O=U ;\ 9c 7k4s3}1/.-,+++++{nbWLI EB%?.<59;7A4G2M0S-Z+a (i &r $| " !       }oaUJC> ;7 4'1.-3*9(>%C"I OV]foz      pbUI>84/+( $& */48>C IPXajt}4&1*1+4/=0H /S .^ -i+s*|*)((('''&&&&&%%&&%%%%%"2)/..024<5F 4Q 3\ 1g0q.z--,,+++*****)))))(((((%0-,2,619::C :N 8Y 6d5n3w21100///.......--,,,,,*-2)6(V <`:j9t7|765544333333332111111.*5&;%B,F5G> FG DR B\Ag?p=x<;;:99988888876!6#6$6$6$6$6$2':"A#H*L2M:MC KM IXGbElCtB|A@@??>>= = =!G!N'R.T6S? QH OSM^KgJpHxGFE D"C#C$B$B%A&A'A'A'A)@+@,@-@-@-@-@-: BLS$X*Y2Y:XC VNTYRcPlNsLz!K#J%I&H'H)G*F+F,F,E-E-E.E0E1E1E1E1E1E1>GQX!]&_-_5^= \I ZTX^UgSo Rv$P|&O(N*M,L-L.K0J1J1J2J3J3J4J5J5J5J5J5J5AKV]a"c(d.d8bE `P]Z[cYk"Wq&Ux)T~+S-R/Q1P2O4O5N6N7N7N8N8N8N8N8N8N8N8DOY`eh!i'i3gA eLcV`_^g#\n'Zt*Yz-X0V2U4T6T7S9R:R;R;RV?V?V?W>W>W>W>W>W>IV`fknpq,p: nFlPiYg`$eg(cm,bs/`y2_5^8]:\<[>Z@ZAZAZBZA[@[@[@[@[@[@L Y b i nqsu*t7rCpMmVk]#id(gk,fq0dv3c|6b9a;`>_@^A^C^C^D^C^B_A_A_A_A_AN [ d kptvx'x5vAtKqSo[#mb(kh,in0ht3gz6f9dwHuQsY"q`'of,ml/lq3kw6i~:h=g?fBfDeEeF~eF}eF}fE}fD~fC~fC~fC~fCS_hpvy| ~"~0}< {FxOvW!t]'sd+qi/po2nu6m|:l=k@jB}iE{iFyiGxiGxiFxiExiDxiDxiDxiDxiDUajrx| .: ~D|MzU x\&wb+uh/tm2rs6qz:p=|o@znCwnEvmGtmGsmHsmGsmFsmEsmEsmEsmEsmEWdmu{,8 BK~S}Z%{`*yf.xl2wr6}vx9zu=wt@usCrrEpqGoqGnqHmqGnqFnqEnqEnqEnqEnqEZfpx~)6 @IQX$^)~d-~}j1{|p5x{v9uz}GOV"\'}b,zh0vn4st7p{;m~>j}Ah}Ce|Ed|Fc|Fb|Fc{Ec{Dc{Dc{Dc{Dc{D`lv#0; DLT |Z%x`*tf.ql2nr5ky9hZ@YAWAWAWAWAWAWAWAWAhu)5}?xGtOpUl\#ib'fh+cn.`u2]|5Z8W:U: 74"2*/2-8+?)E'L%S"Z cmxyk]QF;40,)&$#) /5;AGOW `ju|m^QD9/*%! !% + 05;BIR\fq{1.!.!1$;%F$Q#]!g q z                       /",%+'0*9*D)O(Z 'e %o $x $ $ # # # " " " " ! ! ! ! ! ! !      ,&)*(..071A0L.W -b +l *u )} ) ( ( ('''''&&&& & &%%%%%%%)+&.%4,858>7I5T 3^ 2h 0q /z /..----,,,,,,,++******'/#4";*>2?;>Ei=r>===<<<<< ;!;";#;#;#;#6=GM Q&R-R6P?NK MV K`IiHpGwF}EDDCBB B!A"A"A#A$A%@&@'@'@'@'@'9CLRV!W(W/V9UFSQ Q[PdNlMrKyJI I!H#G$G%F&F'F(F(F)F*F*F+F+F+F+F+=GPVZ\!['\3[AYM WWU`TgRnQtPz!O#N%M&L(L)K+K,J,J-J-J.J.J.J.J.J.J.@K TZ^__a/`=_I ]S[\YcWjVp!Tv#S|&R(R)Q+P-O.O/O0N1N1O2O2O1O1O1O1O1C O W ] a b de,e:cE aO_X^`\gZm"Ys%Xy'W*V,U.T/T1S3S4S4S5S5S4S4S4S4S4S4ERZ`cfhj(i6hB fLdUb]`c_j#]p&\u([{+Z-Y/X1X3W5W6W7W7W7W7X6X6X6X6X6HU]bgikm%m3l? jIhRfZdacg#am&`s)_y,^.]1\3\5[7[8[9[:[9[8[8[7[7[7[7KW_ejmnp"q1o= nGlPjWh^gd#ej&dp)cv,b|/a1`4_6_8^:^;^;_;_:_9_8_8_8_8MYahmpr st.s: qEoMnUl\jb"ih&hn)gt,fz/e2d5c7c9}b;|b<{b {GyOxVw\ ub$th(|sn+yrt/wq{2tq5rp8po:nnUFRM PT N[KbIiFqDzB?><<<;::::ÃzmaWRP"N-L7J@HHFODVB] @e >m -<6;?:G8O7V5_4g2q0|.ӈ-Ә+ӫ **) ) ) ) ) reYND:2/."-+,4+=*E)M(U&^%h#r!~ sfYMB8/*'%"& -4;BJS\fr ~  vgYMA6,$ %+ 17>FOYdp}xiZM@4)  &,29AJU`lx/,+/9DP[fox,)(-7BMXcmv})& %$+'4&?%J$U"`!j rz     &$#&",*.2.;-F+Q*\(f'o&w&~%%%%$$$$$$#### # # # # # # $#(-3'6/685B3M1X/b.k-s-z,,, + + + + + + * * * * * *)))))(-5:#=+=4<=:H8S7]6f5o4v 3} 3 3 2 2 2 1 1 1 1111000////-2;AC&D.C8AA?M>X=b>===<<<<<<<;;;;5> FKNN!M)M5MBLNKX IaHhGoFuE{DDCCBBAAAAA A!A!A!A!A!A!8 B J ORRQ S0S>RIQS O\NdMkKqKwJ|IHHG G!F"F#F#F$F$F%F%F%F%F%F%;GNSU U WX+Y9XEVO UXS`RgQmPsOxN~M L"L#K$K&K'J'J(K(K(K(K(K(K(K(>JRVYY[]'^6]B[L ZTX\WcViToSuS{ R"Q$P&P'O)O*O+O+O+O+P+P*P*P*P*BMTY]^`b$b2a>`H ^Q]Y[`ZfYlXrWw"V~$U&U(T)T+S,S-S.S.T-T-T,T,T,T,EPW]abc e f/e;dE bNaV_]^c]i\o [t"Z{%Y'Y)X+X-W.W/W0W0X/X.X.X.X.X.HRY`dfg ii,i9hC fLeScZb`af`l _r#^x%](]*\,\.[0~[1}[1|[2|[1|\0|\/|\/|\/|\/JT\chijlm*l6k@ jIiQgXf^eddj cp"bv%a}(a+}`-{_/z_1x_2w_3v_3v_2v_1v_0v_0v_0v_0MW_fkmmop'p4o> nG lOkVj\hbgggm"ft%}e{(ze+xd-vc0tc1sc3rc3qc3qc2qc1qc0qc0qc0qc0OYbinpprs$s1s<qE pMoTnZm`lf|kl"zjr%xiy(vi+sh.qg0og2ng3mg4lg4lg3lg2mg1mg1mg1mg1Q\elqstuw"w/v9uC tJsRrX}q^zpdxoj"uop%snw(qm+ol-ll0jk2ik3hk4gk4gk3gk2hj1hj1hj1hj1T_hotwwy z{,{7z@ yHxP|wVyv\vubsth!qsn$nsu'lr}*jq-gq/ep1cp2bp3bp3bo2bo2co1co1co1co1Wblsx{{}~)4> ~F {}Mw|Tt{Zqz`ozf lyl#ixs&gw{)dw,bv.`v0^u1]u2\u2\u1\t1]t0]t0]t0]t0Zfow|&1};yC uKrRoXl^idgj!d~q$a~y'_}*\},Z|.X|/W{0V{0V{0Wz/Wz/Wz/Wz/Wz/_kt{!|-w8s@ pH lOiUg\dbah^o!\w$Y'W)T+S,Q-Q-P-P-Q,Q,Q,Q,dpy} xt)p4m=iE fLcSaY^_[fXmVt S}#Q%N'M(K)J(J(J)J)J)J)J)ju|uol$h/e9bA_I \P ZVW\UcRjPrM{JH!F"E#D#D"C#C$C$C$C$q|vke b_*\4Z=WEULRS PY N`KgIoFxDB@?>==<<<<y}pc[VT"R-P7N?LGJNHUE\ Cd Al ?u=;977665555ui]QJ GE%C/A8@@>H=O;W:_8g6q4{ 2 0 / . - - , , , , yk_SH>8 53$2-16/>.F-N,W+`)j(u&́$͐#͢"͸!!    {maTI?5+$ ! )2:CLU`kwކߗ߫ ~pbUI>3) !) 0 8@IS^kxrcUH<1'  &-4=FP\iwufWI<0$ "(08BMYfs + ( ( , 7 B MYdmv~(%%*4?KV a k s {        %"!(1<GS]gpx~"$&%/$8"C!OYclt{"'+"-+,4+?)J'U&_$h$p#w#~#""""!!!!!!!"""! ! ! ! #&.24'4/290D/O-Z,c,l+s+z+*****))))))) ) ) ) ) ) ) (- 49:!:*836>5I5T4^4g3n3u2{221 1 1 1 1 0 0 0 0 0000000, 3 :>@?"=+<6=C=ODJCTB]Ae Ak @q ?w?|>>===<<<<<<<<<<<3=DGHF HJ,K:KFJPIY H` GgFmEsDxD~CCBBBAAAAAAAAAA7AHKMLNP'Q5PAPLNT M\ LcKiJoJtIzHHGGGFFFFF GGGGG;EKORRSU#V2V>UHTQ RX Q_PeOkOqNvM|MLLK K!K"K"K#K"K"K"K!K!K!>HNTWWX Z[.Z:YDXM WU V\UbThSnRsRyQQP P"O#O$O%O%O%P$P$P#P#P#AJRX[\\}ICC_PROFILE^_+_7^A]J [R ZYY_XeWkWpVvU}U T"T$S%S&~S'~S'}T'}T&}T%}T%}T%}T%DMU[_``ab(b4b?aH _O ^V]\\b\h[nZtY{Y!X#}X%{W&zW(xW(xW)wX(wX'wX&wX&wX&wX&FOY_bccdf%f1e<dE cM bTaZ``_f_k^r}]x{]!y\$w\&v['t[)s[)r[*r[)r[(r['r['r['r['IS\bfgfhi"i/i:hCgJ fQeXd]~cc|cizboxavva~"t`$r`&p_(o_)n_*m_*m_*m_)m_(m_'m_'m_'KV_eijiklm,m7l@kH jOiV}h[zgaxggvfntftqe|"od$md&kc(jc*ic*hc+hc*hc)ic(ic(ic(ic(MYbhlmmn pp)p4p>oF ~nM {mTxmZvl`skfqklojsmiz!ki$hh&gh(eg)dg*cg*cg*cg)dg(dg(dg(dg(P\ekoqprst&t2t;}tD zsK wrRtqXqq^opdlojjoqhnx!fn#cm&am(`l)_l*^l*^l)^l)^k(_k(_k(_k(T`hosttvxy#y/|y9xyAuxI rwOowVlv\jvbguhetoctv`s"^s$\r&Zr(Yq(Xq)Xq(Xq(Yp'Yp'Yp'Yp'Xdlswxy{|~{~,w6s~>p~F m}M j}Sg|Ye|`b{f`{m]zt[y} Yy"Vx$Ux&Sx&Sx'Rw&Rw&Sv&Sv&Sv&Sv&]hqw{|~} xt'p2m;jCgJ dQ aW_]]dZjXrU{SQ!O#M#M$L#L~#L}#L}#L}#L}#cmv}|upl"i.f7c@`G^N [T YZVaThQpOyLJHGFFFF F F F is|tmg c`)^3[<YCVJTQ RW P^ MeKmHvFDBA@??????pz}pe^YV"T-R6P>NFLMJSHZ Fb Cj As?}=;:9887777wvj^TN KH&G/E8D@BG@O?V=^;f9o7z 5 3 2 0 0 / / / / / |ocXLB=;9'80685@4H3O1X0a.j,u*)'&%%$$$$tg[OD90+)'%&-%6#>"F!O XbmzLjǚǮxj\PD9/& ( 1 9 C MWco}ԍՠմ{l^QD9.$ &.7AKVcp~o`RD8,!  #+4>IUbp~qbSE7+&0:FSan|'$$)4?KWbks{$! '1<HT^hpx~ !  %/9 D P[emu{"+5@LV`iqx ~     "#(!1;FQ\elsz &)*")+'5%@#L"V!`!h!o!u!{!!!!!!! !  !!!!!!!! &-00/$-.*9*E*P+Z+c+j*q*w*|**)))))))))) ) ) ) ) ) %-36 641$123?4K4U3^3e3l2r2w1}11100 0 0 0 0 0 0 0 0000)28;: 77:-;:?=?A(B6CABLBUA\@c@i ?o ?t >z >===<<<<<<<<<<<2;@DFEEG#I1I=IGHPGXF_ Ee Ek DpDvC{CBBBBAABBBBBBB6?EJLKK MN-N9NDMLLTL[ Ka Jg ImIrHxH~GGGGFFFGGGGGG:BJORQPRS)S6S@RIQQPX P^ OdNiNoMuM{LLKKKKKKK~L~L~L~L=ENSVVUVW&X2W=WFVNUU T[ SaSfRlRrQxQP~P}P{OzOyOyPxPxPxPxPxP@IQWZZYZ[#\/[:[CZKYR XX W^WdViVo~Uv|U}zTxTwTuStS sS sT sTsTsTsTsTBLUZ^]\]_ _-_7_@^H]O \V [[~[a|ZgzZmxYtwY{uXsXqXpW oW!nW!mX!mX nXnWnWnWDPX^aa`a bc*c5b>bFaM ~`S {_Y y__w^eu^ks]rr]yp\n\l\k[!i[!i["h["i[ i[ i[i[i[GS[addcdef'f2f;eC}eJ zdQ wdW uc]sbcqbiobpmawkai`g`f`!e_"d_"c_"d_!d_ d_d_d_JV^dggfhij$j/j9{jAxiHuiO shU pg[ngalggjfnhfvfe~debdad!`d!_d"^d"_c!_c _c_c_cNYbgjjjkmn ~n,zn6wn?snFqmM nmS llYjl_gkeeklcktaj|_i]i\i Zh!Zh!Yh!Yh Zh ZgZgZgR]ekmmmoq |rxs)us3rs<osDlsK irQ grW eq]cqc`pj^pr\ozZoXnVnUn Tn Tn TmTmUlUlUlWaiopqrt{vvwrx%oy0ly9iyAfxHdxN bxU _w[]wa[vhYvpVvxTuRuPtOtNtNtNsNrNrNrNr\fnstuw|yu{o}l~!i,f5c>`E^L\R Z~X W~_U}fS}mP}vN|L|J{I{H{H{HzHyHyHyHyakswxz|tmh da'^1\:YAWHUOSU Q\ Oc LkJtH~FDBAAAAAAAgqy{}zne_[X"U,S5Q=ODMKLRJYG` Eh Cq A{?=;:::9999nxui_VQ MK&I/G8F?DFCMAU?\=d;m9x 7 5 4 3 2 2 1 1 1 1 v{odXOFA?=(<0:89@8H6O5W3`1i0t.,*)((''''~ti^RG=51/.(,0+8)@(G'P&Y$c#n!zymbVJ?4+"%-5>FPZf r rfXL@5*   "*2<EP[hų̻̈́̕whZM@4)!(1:DO\iwއޘީݷzk\N@4' %-7BN\jx}n_PA3& !*4?M[iw$! &1=IT_hpw~ $.:FQ\emt{!+6BMXaiqw}    ' 2=HS]emty #-7C N X a i o u {     '1<GR[dkqw|%' &# )4A L V _!f!l!r!w!}!!!  !!!!!!!!!!!&+,* '%'.);*G*Q*Z*a*h*n*s*x*})))))))))))))))#,00/+.0)263B3L3U3]2c2i2o1t1y1110000 0 0 0 1 1 0 0 0 )1488568$:1:=;G:P:X9_9e9j8p8u8{7 7 7 7 7 7 7 7 777777.5:?@>= ?@-A9ACAL@T@[?a?f>l>q >w =} = = ===========28@EGECEF(G5G?GHFPEWE]DcDh Dn Cs Cz CBBBBBBBBBBBB5=EJLJIJK%L1L;LDKLKSJZI_ Ie Ij Hp HvH~GG~G}G|G{GzGzGyGyGyGyG8BJOQONOP!Q-Q8PAPIOPOVN\ Nb Mg Mm ~Lt}L{{LyLxKvKuKtKtKsKsKsKsKsK:FNSUSQS TU*U5U>TFTMSSRY ~R_ |Qe zQkyQqwPyuPsPrPpPoPnPnPnPnPnPnPnP>IQVXWUV WX'Y2X;XCXK}WQ{VWxV\ wVb uUhsUoqUvpTnTlTkTjTiTiTiTiTiSiSiSAMUZ[ZXZ[\$\/\9~\A{[Hx[NuZTsZZ qZ` pYf nYmlYtkY}iXgXfXeXdXdXdXdWdWdWdWEPX]]]\]^_!`,|`6y`>v_Es_Lq_Ro^X m^^ k^d j]kh]sf]{d\c\a\`\_\_\_[_[_[`[`[HS[```_abc{d)wd3td<qdCocJmcPjcV hc\ gbc ebicbqaay_a^`\`[`Z`Z`Z`Z_[_[_[_LW^bcccef zgvh&rh0oh9mhAjhHhhNfhTdgZ bga `gh^fo\fwZfXeWeVeUeTeTdUdUcUcUcP[befggiyktlpl#mm-jn6hn>enEcmLamR_mX ]m_ [le YlmWkuUkSkQjPjOjOjOiOiPhPhPhU_fhijkznsonqjrgs)ds3bs;`sC^sI[sPYsVWs\ Urc SrkQrsOq}MqKpJpIpIpIoIoInInInZdklmn|pssmugw cx`y%^y/\z8Yz?WzFUzMSzSQyZOya Myh Kxq Ix{GxEwDwCwBwBvBuCuCtCt_inpqswvlye|`~[X V+T4R;PCNILPJWI^GfDn Bx @ >=<;~;~;};|;|;|fostvxs{g_WR OM%K.I6G>FEDLBSAZ?b=k;u9 7 6 4 4 3 3 3 3 3 luwy{y~nbYPIEB@(>0=8;?:G9N7V6^4g2r0~.-,+*****t{|~sh]RI@9 64 2)01/9.@,H+P*Y(b'm%y#" |ymbWLB8/( %# !( 08@HQ[gs rf[PE:0&  % .6?IS^kxwk_SH<0% %-6?ITan}ōşű~qdVI<0$  #+4=IUcqրֱֽ֑֣wgYJ</#'1;HVdszk[L>/" $.9GUet #.:FQ\emtz!+7CMXbjqw}'3>IT^fmty~ #.9DOYbipuz    (3?JT]ekqv{ " ,8CN X ` f m r w | #0=HRZbhnsx}"! *7 C!M!U!]!c!i!n!s!y!~!!!!!!!!""""""%')($$'%)2*=*H*P*X*_*e*j*o*t*z**************#)/22/-01-282C2L2S2Z2`2f2k1p1v1|1111111111111(.6::7578(949>9G9O9V9\8b8g8l8r8x7777 7 7 7 7 8 8 8 8 8 +5<@A><=>$?0@:@C?K?R?X>^>c>i>o=u=|= = = = ~= }= |= {= {= z= z= z= /:AFFCABDE,E6E?EGENDUD[C`CfCkCr~Cy |B {B yB xBvBuBuBtBtBtBtBtB3?FJJHFG HI(J3J<JDIKIRIW~H]|HczHiyHo wGv vG~ tG rGqGpGoGnGnGnGnGnGnG8CJMMLJKMM%N/N9NA~NH|MOzMTxMZvL`tLfsLl qLt pL| nLmKkKjKiKiKhKhKiKiKiK<FMPQPNOPQ!R,R6|R>yREvRLtQRrQXpQ]oPdmPj lPq jPz iPgPfPePdPcPcPcOdOdOdO?JQSTSQSTU}V)yV3vV;tVCqUIoUOmUUkU[jUbhUh gUp eTx dTbTaT`T_T^T^S_S_S_S_SCMTVVVUWX |YxY&tZ0rZ9oZ@mZGjYMhYSgYYeY`dYf bYn aYv _X]X\X[XZXYXYWZWZWZWZWFPWXYYYZ|\w]s]#o^-m^6j^>h^Ef^Kd^Qb^Wa^^_^e ]]l \]t Z]~X]W\V\U\T\T\U[U[U[U[JTZ[\]\~^w`ranb jb*hc3ec;ccBacI_cO^cU\c\ZbcXbj Wbr Ub|SaRaPaPaOaO`O`P_P_P_NX]^_``xcqdlfhgeg'bh0`h8^h@\hFZhMXhSWhZUh`Shh Qgp Ogz NgLfKfJfIfIfJeJdJdJdS\`acdzergkifk bl_m#\m-Zn5Xn=VnDUnJSnQQnWOn^MnfKmn Jmx Hm FlElDlClCkCkDjDjDjXadefhtjkmeo_q[rWsUt)St1Qu9Pu@NuGLuNKuTIt[GtcEtlCtu At @s >s =s =r |i<{s:{~8{7z 6z 5z 5z 5y 5x 5w 5w djlmowqltaxY{PJFDB(@0>7=>4*    (08BLWcq}pdXLA6+   (08BMZguvi\PD7+&.7BO\kzЊМϭϹ|obUF8+ #,6BP^n}vgXH9+ )4BQ`p!+8BNYbjqw|(4?JU_gnty~ $/:FQZcjpuz  *5ALV^elqv{$/;GPYagmrv{  (5@KT[bhmrw|  -: D N V ] c i n s x } &3>HQX_dioty~!#! .!9!C"L"S"Z"`"e"j"o"u"z""""##########*-+(% ')(*4*>*G*N*U*[*a*f*k*q*w*}*+++++++++++!*1430-/0#1/292B2J2Q2W2]2b2h2m2s2z222222~2}2|2|2|2|2&18:974578+858>8F8M8S8Y8_8d8j8p8v}8~|8z8y8x8w8v8u8u8u8t8t8,6=??<:; <=&>1>:>B>I>P>V~>[|>a{=fy=mx=tv={u=s=r= q= p> o> o> n> n= n= n= 1;BCCA?@AB#C-C7C?}CF{CLyCRwCXvC^tBdsBjqBqpBynBmB kB jB iB iB hB hB hB hB hB 5?EFGECEFGG*|G3zH;wHCuHIsGOqGUpG[nGamGgkGojGwhGgG fG eG dG cG cG cG cG cF cF 9CHIJIGIJ ~KzK'wK0tL8rL@oLFmLLlKRjKXiK_gKefKleKucK~ bK `K _K ^K ^K ^K ^K ^K ^J ^J =FKLMMKM~N yOuO#rP-oP5lP=jPDhPJfOPePVdP\bPcaPj_Ps^P| ]P [P ZO YO YO YO YO YO YN YN @JMOPPNPyRtSpS mT*jT3gT:eTAcTGbTN`TT_TZ]Ta\Ti[TqYTz XT VT UT TS TS TS TS TS TR TR DMPRSSR{TtVoWkWhX'eX0bX8`Y?_YE]YL\YRZYYYY_WYgVYoTYy SX QX PX OX OX NX OW OW OV OV HQSUVV}VvXoZj[ f\b\$`]-]]5[^<Z^CX^JW^PU^WT^]R^eP^mO]wM] L] K] J] I\ I\ I\ J[ J[ J[ LTVXYZxZp]j^d``a]b!Zb*Xc2Vc9Tc@ScGQcNPcTNc[MccKckIcuHcFb Eb Db Cb Ca Ca D` D` D` QWY[\~^r_jbdc^eYfVgTh&Qh/Pi6Ni=MiDKiKJiRHiYGi`EiiCirAi}@h?h >h =g =g =f =f >e >e V[]^`yblddg]iWkRm OnLn"Jo+Ho3Go:FpADpHCpNApV@p^>pfIR[bhmrv{ !-9CMU]cinrw{ &2=GPW^dinrw{+6AJRY_dinrw}  # / : D L SZ_ejnty )4>GNU[`ejpu{%%$" #"/"9"B#I#P#V#\#a#f#l#q#x#$$$$%%%%~%~%~%&,-,*'&()**4+=+E+L+R+X+]+b+h+n+t+|~+|,{,z,x,x,w,v,v,v,u,#-2331/. /0%10192A2H1N2T~2Y}2_{2dz2jy2qw2yv2t2s2r3q3p3o3o3n3n3n2)368865456!7,747=|7Dz7Jy7Pw7Vv7[t8as8gq8np8vn8m8l8k8j8i9i9h8h8h8h8.8:<<;:::;~<({<1x<9v=@t=Gr=Mp=So=Xm=^l=ek=li=th=|g=e=d>c>c>b>b>b=b=b=2<>?@?>>? |@x@$uA-rA6pA=nAClAJjAPiAVgB\fBbeBidBqbBzaB`B_B^B]B]B]B]B]B]A6?ACDCAB{CwDrE!oE*lE2jE:hF@fFGdFMcFSbFYaF`_Fg^Go]Gx\GZGYGXGXGWGWFWFXFXF:BDFGFD|FvGqHmIjI'gJ0eJ7bJ>`JD_JJ^JP]JW[K^ZKeYKmXKwVKUKTKSKSKRKRJSJSJSJ>DGHJJHxJqLlL hMeN$bN-`N4]N;\NBZOHYONXOUWO\UOcTOlSOuQOPOOONONOMOMNNNNNNMBGIKMMzLsNlPgQ cR`R!]R*[S2XS9WS@USFTTLSTSRTZPTbOTjNTsLT~KTJTISHSHSHSIRIRIREJLNPPuPnRgTbU^VZWXW'UX/SX6RX=PXDOYJNYQLYXKY`JYhHYqGY|FYDXCXCXCXCWCWCVDVJMOQSzTpThWbY\ZX[T\R]$O],N]3L^:K^AI^HH^OG^VE^]D^fB^oA^z@^>^=]=]=]=\=\=[>[NPSUVvXjYb\\^V_Qa NbKc Ic(Gc0Ed7Dd>CdEBdL@dS?d[>dcj3=j:;kA:kH9kP8kX6ka5kj3ku2j0j/j/i.i.h/g/g/gVXZ\v^l``cYfQhJkCn>o ;p9q7q(5q/4r63r=1rD0rL/rT-r],rg*rr)r(q&q&q%p%p%o&n&nZ]_|arbhe]hTkLnDqx6{.~&" #+29BJT^jw   ~ ~df}hsjim^pStIy@|7/& # + 3;DNYdqjlxnnpctXxM}C90'  %,4=GR^kyp~qtshw\|QF;1'%-5?JVcqvzxm|aUI>3(%-6@MZhx}sfZNA5) "+5BO^n~ŐŢŲŽyl`SF9,  *5CRbs܄ەۤۯ۳sfYL?1" )6EUfv %1=IS\djpuz~  !-9DOX`flqvz)5@JS[bhmrv{ $0;ENW^dinrv{*5@IQX_dimrv{$/:CLSY_dimrv{ (3=FMTZ_dimrw} ,6@HOUZ`dinsy    %09BIPV[`ejpv}*4=DKQW\aflry}|{zyxwww"%&&$" "%#/#8#@$F$M$R$X~$]}$b{$hz$ox%vw%v%t&s&r&q&p&p&o&o&o& (+,,+)'() ***3+;}+B{+Hy+Nw+Tv+Yt+_s+er,lp,so,|n-l-k-j-i-i-h-h-h-h-&-0121/.. /}0&z0/w17u1>s1Er1Kp1Pn1Vm1\l2bj2ii2ph2yg3e3d3c3b3b3b3a3a3a3+14565434 z5v5"s6+q63n6:m6Ak6Gi6Mh7Sf7Ye7_d7fc8na8w`8_8^9]9\9\9\8\8\8\80479:98~8y9t9p:m:(j;0h;7f;>e;Dc;Ja;P`V>V=V=V=V=V<48:<>=<y<s=o>k?h?$e?-b?4`?;_@A]@G[@MZ@TYAZXAbWAjVBsUB}TBSBRBQBQBQBQAQAQA7;=?AA{?t@nBjB fCbC!_D*]D1[D8YD>WDDVDJUEQTEXSF`RFhQFqPF|OFNFMFLFLFLFLELELE:=@BD~DwBpDjFeGaG]HZH'XH.VH5TH<RIBQIHPIOOJVNJ^MJfLKpKKzIKHKHJGJGJGJGIGIGH=@CEGzGrFkHeJ`K[LXLUM$SM,PM3OM9MN@LNFKNMJOTIO\HOdGOnEOxDOCOBOBOAOANBNBMBM@CFHJvKmJfM`NZOVP RQOR!MR)KR0IS7HS=GSDFSKDTRCTZBTbATl@Tv?T=T=TYP=YW^*=^1;_8:_>9_E8_M6_U5_^4_g3_r1_~0_/_.^.^.^/]/\/\KNP~RsTiV]YV[O]I_Ca>c ;d8d7e&5e-4e42e;1fB0fI.fR-f[,fd*fo)f|(e'e&e%d%d&c'b'bORTyVnXeZY]R`KbDe=g6j2k/l.l!,l(*l0)m6(m>&mE%mN$mW"ma!mlmyllkkkjiiTVYt[j\a^VbMeFh>k7n/p(s%t#t!t#t*u1u9u@uIuRu]uhuutt s r r qppY[z]o_fa\dRhHk@n8r0u(w z| }}}$~+ ~3 ~; ~C}M}X}c}p|~|{zyyxx^`ubkdafWjLnBr:v1y)|   %-5>GR]jyd{fpgfi[mQrFv<{2)   '.7@KWdrivklm`qUvJ{?4*    '/8CO\jz{orqeuYzNB7+  &/9FSaqxvkz_RF:." %/;HWgxq~dXK>1$$/=L\m~Տՠխյk^QD7)  "/?Par ".:EPX`glqvz*6AKT\chnrw{ &1<FPW^dinrv{!,7AJRY_einrvz &1<EMTZ`dimqv{!+5?GOUZ_dhmqv| %/9AIPUZ_dhmrw~(2;CJPUZ_dinsz !+5=DKQV [ ` e j p w  ~ } | { z z y y  %/7?FLQW\a~g|m{ty|xvutsrqqpp *2:~A|G{MyRwXv]ucsirqpyomlkj i i i h h !$&'&%"! "}#%z#.x$6v$=t$Cr$Ip$No%Tn%Zl%`k%fi&nh&vg&f'd'c'b'b'a'a'a'a'"&)+,++)}(y(u) r*)p*1n*8l+?k+Ei+Kg+Pf+Ve+\c,cb,ka,t`-}^-]-\.\.[.[.[.[-[-&*-010/{.w.s.o/l/&i0.g05e0;d0Ab0G`0M_1S^1Z]1a[2iZ2qY3{X3W3V3U3U3T3U3U3U2*.1354{3v3q3m3 i4f4"c5*a51_58]5>[5DZ5JY6PX6WV7^U7fT7oS8yR8Q8P8O8O8O8O8O7O7-1478}8w7q6l7g8c9`9]9'[9.Y:5W:;U:AT:GS:NR;UQ;\PX>$U>+S>2Q>8O>>N?EM?KL@SK@ZJ@cIAlHAvGAFAFAEADADAE@E@E?37:=~>v?o=h>b@]AYA UBRB!PC(NC/LC6JC<ICCHDIGDPFEXEEaDEjCEtBFAF@F@E?E?E@D@D@C6:=@{ArBjAcC]DXETF PGMGKG&HH-GH3EH:DH@CIGBINAIV@J_?Jh>Js=JN>=NEW:X8Y6Y$4Y+2Y11Z80Z?/ZG-ZO,ZX+Za)Zl(Zx'Z&Z%Y%Y%Y%X&W'WDHKuMkObPXRPUIWCY<[6]2_ 0_.`,`'*`.)`4'`<&aC%aK#aT"a^!aiav```__^]]IL|OpQfR]TTWLYE\>^7a0d*f&g$g"g" g)h0h7h?hGhQh[hfhrggffeddcMPwSlUbWZXP[G_@a8d1g)j"mo oop$p+p2p: pB}ICC_PROFILE pL oVoaono|nmmlkkjS~UqWgY^[U^KaBe:h2k*n"qtv x xxx&x-x5x=xGwQw\wiwvvuttsrrXxZl\c^Z`PdFhLZj{pocsWxK~>2& (4BQ`qix]}PC6)  )6EUfxϊϜΪͶcVI<. )9I[l}+6AKT\chmrv{ '2=GPX^dinrv{"-8BKSZ`ejnrv{(3<FNU[`eimqv{ #-7@HOV[`dhmqv{'1:BJPV[_chlqv| !+4<DJPUZ_chlrx $.6>EKPUZ^chnt|~}|||'08?FKQUZ_ej}q|yzywvutssrr   * 2 : @~ F} L{ Qz Vx \w av gt ns vqpnmlkjjii ~${-y5w<uBtHrMqRoXn^ldkkish}gedcbbaaa!"! }yvs(p0n7m=kCjIhNgTeZdabha q` z^ ]!\![!Z!Z!Z!Z!Z! $&''}&x$u"r"n#k#$i$,g$3e$9c$?b%E`%K_%Q^%W\&^[&eZ&nX'xW'V(U(T(S(S(S(S'S'$(*,},w+r*o(k( h(e) b)(`*/^*6\*<[*BY+GX+NW+TU+[T,cS,lR-vQ-P-O.N.M.M-M-M-M-#(+.0x0s/n.i-e.b.^.\/$Y/,W/2V/8T/>S0DQ0KP0QO1YN1aM2jL2tJ2J3I3H3G3G3G2H2H2&+/1|3t3n2i1d2`2\3 Y3V3!S3(Q4/O45N4;L4AK5HJ5OI6WH6_G7hF7rE7}D7C8B8B7B7B7B6C6).24y6p7j6e5_6Z7V7 S8P8N8%K8,I82G88F9?E9FD:MC:UB;]A;f@<=<<<<;=;=;>:,157u9m:f:`9Z:U;Q<N<K=H=#F=)D=0B=6A>=@>C??K>?S=?[<@d;@o:@z9@8@8@7@7@7?8?8>048|:r<i=b=[=U>P@L@HA EACB @B'?B.=C4u@kBbCZDQFKHEIAJ=K9M6M4M!2N(1N//N5.N<-OD,OL*OT)O^(Oi'Ou&O%O$O$N#N$M%L&L:>}AqDgF^GVHLKFLAN;P6Q2S /S-T+T%)T+(T2'U9%UA$UI"UQ!U[ UfUrUUTTSSRR>BxEmGcIZJRLIOCQU8X1Z*]#`a bbc#c*c1c9cA cJ cT b_bkbyaa`__^^H{KnMdO[QSRJUAX:[2^+a$cfh j jjj%j,j4j<jEjPi[igithhgffeeMuPiR_SWUOWE[<^4b,e$hjm pq rrr!r(r/r7r@rJrUqbqop~ponnmm}RoUdV\XSZI^@a6e-i%lor uwyy zz{#{*{1{:{D{O{\zizxyxwwvvuXjZa[X]MaCe9j/n&rux{~ #+3=IUcro]f_]`RdFicDaI`O^U]\\cZkYuWVUTSSRSS!#y#t"o mjgdb&`-^4\:[@YEXKVRU YT `R iQ!rP!}O"N"M"L"K"K"L!L!#&{'t(n'j%f$c#`"]#[#"Y$*W$0U$6T$<R%BQ%HO%ON&VM&^K'fJ'pI'{H(G(F(E(E(E'E'F'"&)w+o,i+e)a(](Z( W(T)R)&P)-N)3M*9K*?J*EI+LG+SF,[E,dD,nC-yB-A-@-?-?-?-@,@, &*~-s.k/e/a-],X-T-Q-N.L.#J.)H./F.6E.<C/BB0IA0Q@1Y?1b>1l=2x<2;2:2:29191:1;0$)-z0p1h2a2\1X0S1O2K2H2F2D3&A3,?32>39=4@=4G<5O;5W96a86k76v6666564646455555',0w2m4d5^5X5S5N6J6F7 C7@7>7$<7*:8098789>79E6:M5:U4:_3;i2;u1;0;/;.:.:.:/909*/3s5i7a8Z9T8N9I:D;A;=<;<8=!6=(5=.3=52>;1>C0?K/?S.?]-@g,@s+@*?)?(?(?(>)>*=-2|6p8f:^;V<P<I=D>??;@7A 5B2B0B%/C,-C2,C9+D@*DH(DQ'D[&Ee%Eq$E~#D"D"D!C!C#B#B15x9l;b=Z>S?L@CB>D9E5F1G.H,H*H"(I)'I/%I6$I>"JF!JN JXJcJoJ|JIIHHGG59t<h?_@VAOBHD@F:H5I/K*M&N $O"O O%O,P3P;PCPKPUP`PlPzOONNMML9}=o@dB[DSELFDHvIvUubuqtsrqqpmRbTYUQWF[<_2c)gko ruxz{|} ~%-7AN[j{~}||{gX^YUZJ^@c5h*m quy| &/:FTctc][^ObCg8m,r!w| %0=K[k~`bTgHlGOU[`einrv{ %/9BIPV[`dhmqv{ *3<DKQV[_chlqv|$.6>EKQUZ^bgkqw~(18?EKPTY]bflry "+29@EJOTX]bgmt}~}|{{zz%-4:@EJO~S}X|]{cyixpvxutrqpppoo '}.{5y;x@vEuJtOsTrYp_oenmlukihgffeee {yv!t)r0p6o;mAlFkKiPhVg\ebdjcra|`_^]\\\\ }xu tqnl#j*h1f7e<dBbGaM` R^ Y] `[ hZ qY {W V U T S S S S }uqmkjg eb%`,_2]8\>ZDYIXPVVU^SfRoPzONMLKKKKwpjgdb`][!Y(W.U4T:R@QFOLNSM[KcJmIxGFEDDDDD|!r#k$e#a!^\Y VTQ$O+N1L7K=ICHIG PE XD!aC!kB"v@"?">">"="=!=!>!"x%n'g'a'\&Y$V#R#P"M#K# I#'G#-E$3D$9B$@A%F@%N?&V=&_<'i;'t:(9(8(7'7'7'7'8&!%t(k*c+]+X*U'P'M(J( G(D(B($@(*>(0=)6<)=;*D9*K8+T7+]6,g5,r4,3,2,2,1,1+2+2+$}(q+g-_.Y.T-P+K,G,D,A->-<- :-'8--7.36.:5/A4/I30R10[01e/1q.1}-1,1,1+0+0,/-/!'z+n.d0\1V1P1K0F0B1>1;1 826242$22+131038/4?.4G,5P+5Y*5d)5o(6|'6&5&5%5%4&4'3%*v.j0a2Y3R4L4G4A4=59666 3707.7"-8(+8/*86)9='9E&:M%:W$:b#:m":z!: ::99 8!8(-s1g3^5V6O7I7B8<97:3;0<,<*=(=&=&%>,#>3">: ?B?K?U?_?k?x??>>==<,}0o4d6Z8R9K:E:>;7=2?.@*A&B #C!CC#D)D0D8D@EHERE]EiEvDDC C BBA0x4k7`:W;O<H=B=:?4A/C)E$GHJJJJ&J-J5K= KE KO KZJeJrJIIHGGG4t8g;\=S>K?E@?A7C0F*H%JLNP Q Q Q"Q*Q1Q9QBQKQVPaPnP}ONNMML~8n<b?X@OBHBBC;E3H,K%MPRTWWXXX&X-X5W>WGWRW]WjVxVUTSSSw=i@]CTDLEFF>H6K.N&QSVY[]^ ^__"_)_0_9_B_M_Y^f^t]\[[ZYqBdEYGPHJHAK9N0Q(T X[]`bde efgg$h+h4h=gHgTgafoeedcbbjG^JUKNKENv1}"%6H\nـؑٞ*5>GOU[`eimrv{ &09BJPV[`dimqv|!+4=DKQV[_chlqv|%/7?EKQUZ^bglqw~  )19@FKPTY]aflry#+3:@EJOSX\afls|&-4:@EJNRW\a~h|o{wyxwvuuttt  (/~5|;{@yDxIwNvRtWs]rcqkosn|mkjjiiii}{xv"u)s0r5p;o@nDlIkNjSiYh`fgeodyba``____|wur pmk$j*h0g6e;d@cEbJaO_V^\]d[lZvYXWVUUUU zs o l jh fdb%`,^1]7\<ZAYFXLWSUZTbSjQtPONMLLLL }slgdba _]Z X'W -U 3T 8S >Q CP JO PM XL `J iI tHFEDD C C C wnga^[YXVTQ"P)N/L5K:J@HGGNEVD^ChAr@~?>=<;<< sib\XUSQO LJH%F+E1C7B=AD?K>S=\;e:p9|8765456{o!e"^#X#S"P NKHFCA!?(>.<4;::A8H7 Q6!Z5!d3!n2"{1"0"/".!.!/ / w!k$b&Z&T&O&K$I"E"B"?"=";"9"$7"*5#14#73$>2%F1%N/&X.&b-'m,'y+'*')&(&(%)%)% t$h'_(W)Q)K)G(D&@'<'9' 7'4'2'!0''/(..(5-)<+*D**L)+V(+`'+k&,x%,$+#+"+"*"*#)#p'e)[+T,M,H,C+?+;+7+4,1,.,,,*-%)-+'.2&.9%/A$/J#/S!0^ 0i0v000/... {&m)b,X.Q.J/D/?/:/5/20.1+1 (2&2$2"#3)!30 374?4H4Q5\5h5t5443322#w)j,_/U0N1G1A2<26304,5(6%7!788 8&9-959<9E:O:Z:e:r: 9 9 8 7 7 6's,f/[2R3J4D4>48526,8(9#;<= >>>#?*?2?: ?B ?L?V?b?o?}>>=<<;+o/b2X5O6G7A7;758/:)<$>@BD E E E E'E/E6E?EHESE^DkDyDCBBA@z/j3^6T8K9D9>:8:2<+>%ACEG JKKKK$K+K3K;KEKOKZKgJuJIHGGFt3f7Z:P;H<A<;=4?-A&D FIK MPQ QRR R'R/R7RARKRVQcQqPONNMLn8`;U=L?E???7B0D(G!JMO RTVW XXYZ#Z*Z3Z<ZFYRY_YmX}WVUTTh=[@QAIBCB;D2G*K"NQTWY\]^_ `abc&c.c7cAbMbZah`x_^]\\aBVDMEGE>G5K-N$RVY\_bdeghi jkl m(m1m;mGlTkbkrjhgfe\GRHKICK9N/S%W[_cfikmopqst uwx!y*y4x@xMw\vlu~tsqqWLPMGNe1l$ry (8I\oCj6p(x .@SfzҌќ &0:BJQV[`dhmqv|!+5=EKQV[_dhlqw}&/8?FLQVZ_cglqx  )2:@FKPTY]aflry$,4:@FKOSX\aflt| '.5;@EINRV[agnv~|{zzzzz!(/5:?~D}H|MzRyVx\vbuitrr{qoonmmmm |zy#x)w0u5s:r?qCoHnMmRlWj^iehmfwedccbbbb|wtr pnm$k*j0i5g:f?eCdHcNaS`Z_a]j\s[~ZYXXXXXyrnkigecb%a+_0^5]:[?ZDYJXPVVU^TfRpQ{POONNNNzq j fca_ ][Y X&W,U1T6S;Q@PFOLNSL[KdJnHyGFFEEEE tjc^[Y XV TRP"O(M-L2K8I=HCGJEQDYCbAm@x?>=<<<< zne^YURPO N L J H #F )E /C 5B :A A? H> P< X;b:m8y76543 3 4 uj`YTOLJHGECA?&>,<2;89>8E6M5V4`2k1w0.-,,,- qf]UOKGDC@> <:8"6(5.352;1C/K.T-^+i*u)(&&%%&|nbY!R"L"G!C ?>:8531/%.+,2+9*@)I' R& \%!g#!t"!!! !  xk _"V$O%H%C$?$;#8!5!2!/! -!*!(!!'"(&#/$#6#$>"$G!%P%Z&f&r&&%%$$#ug"\%S&K'E'@';'7&3&/&,&)&&&$'"' '&(,(4)<)D*N*X+d+p+~**))('r!d%Y'P)I*B*=*8)3)/***'+#+ , ,--#-*.1.9/B/L/V/b /n /| / ..-, ,~n$a(V*M+F,?,:,5,0,+-%/!012 233!3(3/ 46 4? 4H4S4^4j4x432210y#j']+S-J.C/ >>?"?)?0?8?B?L?W?d>r>=<<;:p*b.V1L3D4=47424,5&79<> @BC DEEE%E-E5E>EHETE`EnD~CBA@@k/]2Q4H6@6:657.8(:!=?B DFHI JKLM"M)M1M:MDLPL\LjKzJIHGFe3X6M8E9>9891;*>#@CF IKMOPQ RSTU%U-U6U@TKTXTfSvRQONN_8S;I<B<<<4>,A$DGK NPSUWXYZ []^ ^(^1^;]G]S]a\q[ZXWVY=N?F?@?8A/D&HLP SVY[^_abce fhi"i*i5h@hMg\gke}dba`SBKCDCM]o~|{zMKDL9P.V"[afkoswz}(5DTfyIP>U2Z%agmsx},;L^qBY6_)fm t{!1BTh{;d.k rz&8K^rфϕ!+5>ELRW[`dhmrw~&08@FLQVZ_chmrx !*2:AGLQUY^bgmsz%-4;AFKOTX\agmt} '.5;@EJNRW\agow!)/5;@DHMQV~\|b{iyqx{vutsssss ~#}*|0z5x:w?vCtGsLrQqWo]ndllkvjhgfffff}yvs rqp$p*n0l5k9i>hBgGfLdRcXb``h_q^}]\[[[[[xrnkigfed%c+a0`4_9^>\C[HZNYTW\VdTnSyRQQPPQQxoidb`^ \[Z Y&X+V0U5T9R>QDPJOPMXLaKjJuIHGGGGG|pha\YXVT RQP!O&M,L1K5J;H@GFFMDUC^BhAs@?>>>>>vj a Z U R ONMKJHG"E(D-C2A7@=?C>K<S;\:f9q7~765555q e\UPLIG F E CA@>$=);/:49:7A6H5Q3Z2e1p/}..--,-z laXPKFCA?> = ; 9 7 6 &4 ,3 22 80 ?/ G-Q,[*e)q'&%$## # vh]TMGB>;9865 31/#-),/*6)=(F&O$Y#d!p } reZQIC>:7420. ,*(&&%,#3"; CMWbn|obWN F @ ; 63/-*'% " ")18AJ U ` l z     |l^T K"C#=#8"3"/!, ( % " ! !!" "'#.#6$?$H%S %^ %j %w%$$#"!xh[!Q#H$@%:%5%0$,$(#$$%%&'''($ (+ (3 );)E)O*Z*f*s))('&&te X#N%E'>'7'2'-&)&%& ')*+ , ---"-(-0.8.A.K.W.c.q.-,,+*pa#U&J(B);)5)0)+)')")+-. 02 2223&3-353>4H4T4`3n3}2100/k"]&Q)G+?,8,2,.+)+$,-/1 356 7899#9*929;9E9P9]9k8z76554g&Y*M,D.<.5.0.+.&/ 024 78;<= >?? ?'?/@7@B@M@Y?g?w>=;::a*T.I0@19130.0(2!468 ;=?ABD EFGG#G+G4G>GIGVFdFsEDBA@\/O1E3=37313*5#79< ?BDFHIKL NOPP'P/P:PEOQO_NoMKJIHV3K5B6;656-8&:=A DGILNPRSUV XYZ"Z*Z4Y?YLXZWjV|USRQP8F9?9991;(> BE ILPRUWY[\^_a cee$e.d:cGcUbdav_^\[K=C==<5>+B"FJ OSVY\_aceghjln prr'q2q?pMo^moljigHAB@9B.F$KP UY^behjmoqstvx{} +7F}W|h{{ywvFD=F2K'PU [aejnquxz} !.=M_rBK6O*U[bhnsx{ $3CUh|;T.Z!agov| ):M`s3^&fmu} 0CWj|͎&09@GMRW[`dhmsz !+3;AGLQVZ^chmt|%-5<BGLPTY^bhnu (/6<AFJOSW\bhox")06;@EIMRW\bjr|~}{zzzzx#*05:}?|C{GyLxQwWu]tdrmqvonmlllll}zx wvv$u*s0q5p9o>mBlGkLjRhXg_ehdqb}a`____`ztomkjiih%g*e/c4b8a=`B_G]M\SZZYcXmVxUTTSTTTwoieb`_ ^]\\%Z*Y/W4V8U=TBRHQOPVN_MiLtKJIIIIJzof_[XVUT SRR P%O*M/L4K9J>HDGKFSD[CeBpA}@@@?@@sg_XSPNLKJIHG!F&D+C0B5A:?@>G=O;X:b9m8z776777{maX R L IFECB A@?>"<';,:1877=6D5L3U2`1k0x//.../ug \ SLGC ? = <;: 9765#3)2.14/:.B-J,S*^)i(v''&&&&qc XOHB>:76 5 43 1/. ,%++*1(8'@&I$R#]! i v}m _TKD>:630.- - + ) ' % #$ )# /! 7 ? IS^jw   y i\QHA;62.+)'&$ "  '.5>GQ\iv      u fYNE>83.*'$" $+3<E N YerrbVKB;50+'$   ! ( /7@JUbo}n_SH? 8 2 -)%!  !!!"%",#4#=$G$S$_$l${#"! j\OE!="5"0"+!&!"  !" #%& &&'"')(1(:(D)P)\)j(y('%$$fXL"B#:$3$-$(#$" ""#% &(*+ ,,- -'-/.7.A.M.Y.g-w,+*)(bT"I$?&7&0&+&'%"%%&( )+-/0 1333$3,444>4J4V3d3t210/-]"P%E'<)4).()(%'()+ -/13568 9::!:(:1:;;F:S:a9q87643X&L)A+8+2+,*'*!+-/ 1358:;=? @BBB%B-B7BBBOA]Am?>=;:S*G-=.6.0-+-$.0358:=?ACDFH JKK!K)K3K>JJJYIiH{FEDBM/C0:140.0'147:=@BEGIKMOQS UVV$V.U9TFTTSdRuPNMLH3?48423*5!8;?BFILNQSUWY[\_ aaa(`3_@_N^^]p[YXVC7<776.8$<@DHLPSVY\^`bdfhjm oo!n,n8mGkWjih|fec@;;:2<'@EJOSX[_begjlnprtwy|~~$}1|?zPz`wtvtr?>6@+EJPV[`dhlosuxz} '6FYl:E/I#OU\chnrv{,<Nau3N'T[bjqw}!2DWk}+Y` hpx(;NatЅ "+4;BHNRW[_diov~&.6<BHMQUZ^cipx  (07=BGKPTY^ciq{}ICC_PROFILE"*17<AEINSX]dks}{$+16;?DHMQW~^}e{nyxwvtssspo %|+z0x5w:u>tBsGqLpQnXm`khjrhgfeeedc~xtrpooon%l*j/i4h8g=eBdGcLaS`Z^c]m[yZYXXXXXypjgdbb aaa_%^*\/[3Z8Y=WBVGUNSUR^PhOtNMLLLLMzne_[YWVU UUT S%R*P.O3N8L=KCJJHQGZFdDpC}BBABBCqe]VROMLKJJJI G%F*E.D3B9A?@F>M=V<`;l:y988899xj^VOJFDCBA A@@> =%<*;/958;7B5J4S3]2h1v0///00qdXPIC?=;:98 8764!3&2+01/7.?-F,P+Z)f(s(''''(|l^SK D > : 643210 /.-+#*().'4&<%D$M#X"c!p  wgZ O F ?: 5 1 . , +*) ('%$"%!+ 19BKVbo}scV KC<61-)' $ # "! !(/7@JUan|     o` SH?82-)%"       & . 6 @ J T`m{   l ]PE=5/*&"   $+3<FQ]jxh YMB:3-(#   (09CNZhweVJ@70*%!  %-6@KXfuaSG=4.(#   !!#"+"3#>#I#V#d"s"!]OD:2+&!  "#% &'' '((1(;(F(S(a(q'&$#"YL@ 7!/!)!$  "$%')+ ---.%...8.C.P.^-n,+*('TG!=#4#,#'#"!!!" $%')+-/13 455"5*545?5L5[4k3}20/-P!C$9&1&*%%$!$$&(*,.03579; ===='=1=<=H<E*;+2+,*'* +-0369;>ACEGILNP RQQ'Q2P?PMN]MpKIHF@.7.0.+-#.148<?BEHJMOQSUXZ\]]"\-[:[GZWYiW}UTR<25100'259>BFILPSVX[]_adfillk%j2i@hQgbevca_9544*6 :>CHMRUY\_begilnpsvy||{*z8yHwZtnspo98/:$?D JPUZ^cfjnqsvx{}!/@Sew3?'CI PW]cimqvz~%5G[o,HOV]elrx}*=Pcw#T[ckt{ 2FYl}  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~mft1!  !"#$%&'()*+,-./01234566789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~DW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDW3dYkppopwڿ~׽ջӺѹйͷʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵʵDX3eYkppopw~׿սӼѺι˷ƶƶƶƶƶƶƶƶƶƶƶƶƶƶƶƶƶDX2eXjoqopv}ԾѼϻ̹ȸ·················DY2fXjoqpou}Ҿϼ̻ɺŹ߾ᾷᾷᾷᾷᾷᾷᾷᾷᾷᾷᾷᾷᾷᾷᾷᾷEY2gXjnronu}о̽ɼƺ޺ຸຸຸຸຸຸຸຸຸຸຸຸຸຸຸຸEZ1gXjnsnmu}ͿʽƼ»۽ݷ޷޷޷޷޷޷޷޷޷޷޷޷޷޷޷޷EZ1gWjmrlmu}ʿƾýؾٹ۳ݳݳݳݳݳݳݳݳݳݳݳݳݳݳݳݳE[0gWimpjmu|ÿԿֺصٯۯۯۯۯۯۯۯۯۯۯۯۯۯۯۯۯF\0fVilnhlt{€ѿӻԶֱ׬٬٬٬٬٬٬٬٬٬٬٬٬٬٬٬٬F]/fUhkjeltz~Ϳ‚ϺѶұԭը֨֨֨֨֨֨֨֨֨֨֨֨֨֨֨֨G_.eTghfblsyɾ}˹À͵ƒϰ†ЬѨӣԣԣԣԣԣԣԣԣԣԣԣԣԣԣԣԣHa,dRde_bkrľwƸ{ɳˮĂ̪Åͦ‰΢ϞООООООООООООООООI`*aT^_Vbjpuızƫ~ȧƁɣńʠĈ˜Č̙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đ͙đJ ^([YVJWaiotyã}ğȀŜDŽƙLJǖƋȔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐɔƐK W-P_GKW`gnsx|ʀ•ɃÓɇÐɊĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏĎȏC N3QeNIS_fmsx|̀˃ˆˊˎˎˎˎˎˎˎˎˎˎˎˎˎˎˎˎˎ;Q:R^MvKMT^hov{΂Ά͉͍͍͍͍͍͍͍͍͍͍͍͍͍͍͍͍͍8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݣۢڠٟ؞֝՜͖͖͖͖͖͖͖͖͖͖͖͖͖͖͖8K+UM`thklou|ޥݤۢڡ٠מ֝՝̖̖̖̖̖̖̖̖̖̖̖̖̖̖̖8K+VM`tiklou{ީܨڧئץդԣӣțțțțțțțțțțțțțțț8L*VM`tillot߭zݭ۬٬֫ժөҩΨĠĠĠĠĠĠĠĠĠĠĠĠĠĠĠ8L*VL`tillot߰zܰڰװհӰҰб˰8L*WLatjllos޳y۴ٴֵӵѶϷʵǹ߽۽۽۽۽۽۽۽۽۽۽۽۽۽۽8L*WLatjlmos޶y۷ظԹҺϹ˸ķ㿸໵ܻܻܻܻܻܻܻܻܻܻܻܻܻܻ8M*WLatjlmnrݺyڻֽӽϻ˺ƹ߾ฺุܸܸܸܸܸܸܸܸܸܸܸܸܸܸ8M)XLatklmnrݾx~Ͼʼƻܹ޳߲ܲܲܲܲܲܲܲܲܲܲܲܲܲܲ9M)XLbtklmnqx~˿ƽټڵܯܬ۬۬۬۬۬۬۬۬۬۬۬۬۬۬9N)YKbtlmmnpv~ռַر٫ڧڧڧڧڧڧڧڧڧڧڧڧڧڧڧ9N)YKctlmmonv}ѽӸԳխרؤؤؤؤؤؤؤؤؤؤؤؤؤؤؤ9O(ZKcsmmnomu{ͼ‚ϷгҮөԤՠՠՠՠՠՠՠՠՠՠՠՠՠՠՠ9 O([Jesnnpgmtyɼ}˷Ā̲Ãή†ϩ‰Хѡѝҝҝҝҝҝҝҝҝҝҝҝҝҝҝ9 P']Jgsmpkclrļwƶ{Ȱ~ɬŁʨĄˤć̠Ë͝ÏΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓΚÓ: R&`IirkpYdkqµuïyŪ|ƥǢƂȟƅɜňəŌʖŐ˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő˖Ő: S$cGiqi]Ycjotx¤|ĠŝȂƚDžƘLjǕƌȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐȓƐ: V"dEgoYN[ciosx{~˜ɁÕɄÓɈđȋŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏŏȏ;YcA_pKNZbhnsw{~ˁ˄ʇʋʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ‹ʎ:^\ESoLKR^hnsw{~́̄̇̊̍̍̍̍̍̍̍̍̍̍̍̍̍̍̍8VSHNgLzLOU^elqvz}Ӏ҃~҇}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ}Ҋ,K%KEJYJkLyOTZa}hzmxrvvuyt|sr܃q܆q܆q܆q܆q܆q܆q܆q܆q܆q܆q܆q܆q܆q܆q܆- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A#MAYcaimptz⚀ᗇޓݑݏ܎ۍڌφ˄˄˄˄˄˄˄˄˄˄˄˄˄- A"MAYcailpsyߙݗܕۓڒڑՎɇƅƅƅƅƅƅƅƅƅƅƅƅƅ- A"NAYcailorx}ߠޝܛۙژٗؖϐĊ- B"NAYcbjlnqv|ޤݢ۠ٞ؝֜՛ɑҽнннннннннннн- B"NAYcbjlnpu{ިܧڥؤ֢ԡҡŖ׼ҹйййййййййййй- B"NAYcbjlnpu߭zݬګت֩ԨҨ̤ظӵѵѵѵѵѵѵѵѵѵѵѵѵ- B"O@YcbjlmotްzְٰܰԯүЯɬ޼شӲѲѲѲѲѲѲѲѲѲѲѲѲ- B"O@Zcbjlmos޴y۴صյҵжʵŶ߹ٱԮҮҮҮҮҮҮҮҮҮҮҮҮ- B!O@Zcbjlmnsݷyڸ׹Ժк˸÷㾹߶ڮլӬӬӬӬӬӬӬӬӬӬӬӬ- C!O@Zcbjkmnrݻxڽֿн˻Ź޽෹ߴڬթԩԩԩԩԩԩԩԩԩԩԩԩ- C!P@Zccjkmnqx~̾Ƽٿ۸ݱްڪ֧ԧԧԧԧԧԧԧԧԧԧԧԧ- C!P@Zccjkmnpv~ǿ׺ٳڬ۩ڨ֥եեեեեեեեեեեե- C!P@Zccklmnnu}‚ҺԴ֮רؤأ֣ԣԣԣԣԣԣԣԣԣԣԣԣ. D Q?[ccklnmlu{ͻƒϵѯөԤ՟՝ԝӝӝӝӝӝӝӝӝӝӝӝӝ. D Q?[cdlnrdmtyȻ}˴āͯÅΪ‰ϥѠќҘҘјјјјјјјјјјјј. ER?\censeclrúwƴ{ȮɨŃˤć̠Ë͜ÏΘÖşΔãΔãΔãΔãΔãΔãΔãΔãΔãΔãΔãΔãΔã.FT>]cfliXckquìzŧ}ƢǁǟƅțƈɘŌʕŒʒřːŜːŜːŜːŜːŜːŜːŜːŜːŜːŜːŜːŜːŜ.GU=^bidLZcjotx |ÜęȃėȆŔȉƑǎƏǓǎǖǎǖǎǖǎǖǎǖǎǖǎǖǎǖǎǖǎǖǎǖǎǖǎǖ.HXO1[LaTRxKKU_hnrwz~́̈́̇̋̐̕̕̕̕̕̕̕̕̕̕̕̕!?R/b6SWNtLMQY`fkptwz}Ӏ~҄}҉|ҍ|ҍ|ҍ|ҍ|ҍ|ҍ|ҍ|ҍ|ҍ|ҍ|ҍ|ҍAY"Q7NVKlK{NRV[af}j{nyqxtwwvzt~sۂrۆrۆrۆrۆrۆrۆrۆrۆrۆrۆrۆrۆC CI7IOI`JlNvQ}V~Zy_vdthrlpoornumxl|j〗iㄘiㄘiㄘiㄘiㄘiㄘiㄘiㄘiㄘiㄘiㄘiㄘ%;@3CEFSI^MhQo{VuuZyq_}nckhjkhngqftewdzb~a낉a낉a낉a낉a낉a낉a낉a낉a낉a낉a낉a낉!07*=9BEGPLYxQarVfmZki_nfdpdhrbktanu`qv^tw]vx\zy[}zZzZzZzZzZzZzZzZzZzZzZzZz/>,MFY`awhmrx~熅惌偓}{yxwŻuʻt̼s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻/>,MFY`awhmrx~熅惌偓}{yxwŻuʻt̼s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻/>,MFY`awhmrx~熅惌偓}{yxwŻuʻt̼s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻/>,MFY`awhmrx~熅惌偓}{yxwŻuʻt̼s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻/>,MFY`awhmrx~熅惌偓}{yxwŻuʻt̼s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻/>,MFY`awhmrx~熅惌偓}{yxwŻuʻt̼s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻s̻/>,MFY`axhmrw}戄態傓䀚~|{yxǼv˼u˼t˼t˼t˼t˼t˼t˼t˼t˼t˼t˼t˼0>,MGXaaxglqt{拂刉䆑ベ⁢}|zȾxʿvʿv˾v˾v˾v˾v˾v˾v˾v˾v˾v˾v˾0?,MGXaayfkpsx䌇㊎⇗ᄡႫ|yxxʿxʿxʿxʿxʿxʿxʿxʿxʿxʿxʿ0?,MGXaazfjoqv}䐄㍌ዕ߆ބہ}zz¼zzzzzzzzzzz0?,MGXbazeinpt{㔂⑊᎓ߌމ݇Ӄ~}Ƽ|ø|||||||||||0?,MGXb`zeimory㙀ᖈސ܍ۋ̈́ĀʽǸ~Ĵ}}}}}}}}}}}0?,MGXb`zdhlnqv~ޗܔۑ׏ƅϿ˹ȴİ0?,MGXb_zdhkmpt{ߠݝۚؗϑй̴ȯĬ0?,MGXc_zchklnryަܣ١՞ƓػҴͯɫŨ¨¨¨¨¨¨¨¨¨¨0@,MGXc_zchklnqwݭګ֪ҨٵӯΪɧŤ¤¤¤¤¤¤¤¤¤¤0@,MGXc^zcgjkmoߵvܵ}صӵ˵湦ۯԩΥʣơáááááááááá0@+MGXc^ycgjkln߽tۿ|˼ڽവܪդС˟ǝĝĝĝĝĝĝĝĝĝĝ1@+MGXc^ycgklmnpzִ۫ۦՠѝ̛ȚŚŚŚŚŚŚŚŚŚŚ1@+MGXd^xchlmojoyÀθҬ֣آ՜љ͗ɖƖƖƖƖƖƖƖƖƖƖ1@+MGXc]wciosheowǺ~˰…ΦҝӚәЕ͓ɒƒƒƒƒƒƒƒƒƒƒ1A+NGXb]udkkjYenuŲ|ȩŃˠÌ͙—ϕ¥ϓ÷Β̐ɏǏǏǏǏǏǏǏǏǏǏ1A+NGW`^rekaN[emtªzŢǁǛƉɕŒʑĝˎūˍŽʌȋƋƋƋƋƋƋƋƋƋƋ1B*NGW]_mjzdAQ\emsyœÖȆŒǎƎǗNjǢljǯLjƇŇŇŇŇŇŇŇŇŇŇ2B*NGWXddfnKGS]elrx~ʄʊ‹ɒÈɚÆɤąɳĄ„„„„„„„„„2C)NE\PfUPrMJQ\elrw}̂̇ˍ˓˛˦˳˳˳˳˳˳˳˳˳˳˳3D)R=f@RUPsLLOX`hnty~σΈ΍Δ͜~ͦ~ͦ~ͦ~ͦ~ͦ~ͦ~ͦ~ͦ~ͦ~ͦ~ͦ3F'Y.R7RWMpKMQV]dios~x||zցyՅwՋvՒtԚtԚtԚtԚtԚtԚtԚtԚtԚtԚtԚ4 IYN;LVJiKwNRV[`}fzjxovstvrzq~oނnވlݏlݏlݏlݏlݏlݏlݏlݏlݏlݏlݏ5 G D G;HPH`KkNtRzV{Zv^scqgokmnlqjtixh{f瀑e煒e煒e煒e煒e煒e煒e煒e煒e煒e煒e煒+, ;!@6CGFSJ]Me}RjwVorZsn^vlbxiezhi{fl}eo~crbuax`}^^^^^^^^^^^' 18.>;CFHOzLVtQ\oVajZeg^hebjcflaim_ln^op]rq\trZxsY|tXuXuXuXuXuXuXuXuXuXuXu &/#7/?9xEBqKIkPOfUScZW`_Z]b\[f]Zi_Xl`WoaVrbUtcSxdR|eQfQfQfQfQfQfQfQfQfQfQf(8$H:UP_dftkou~||zxvtrpomŴl̴lδmдnдnдnдnдnдnдnдnдnдnд(8$H:UP_dftkou~||zxvtrpomŴl̴lδmдnдnдnдnдnдnдnдnдnдnд(8$H:UP_dftkou~||zxvtrpomŴl̴lδmдnдnдnдnдnдnдnдnдnдnд(8$H:UP_dftkou~||zxvtrpomŴl̴lδmдnдnдnдnдnдnдnдnдnдnд(8$H:UP_dftkou~||zxvtrpomŴl̴lδmдnдnдnдnдnдnдnдnдnдnд(8$H:UP_deuinsz~|zwusqpnȵn̵nϵnеoеoеoеoеoеoеoеoеoеoе(8$H:UQ^ecuhmrx邀|zwusrp˷pηpϷpϷq϶q϶q϶q϶q϶q϶q϶q϶q϶q϶(8#H;UQ^ebvgkpv~肅}zxutĸr˹r͹q͹rθrϷrϷrϷrϷrϷrϷrϷrϷrϷrϷ(8#H;UR]eavfjot{熃悋}zxvɺt̻s̻sͺs͹tθtθtθtθtθtθtθtθtθtθ(8#H;TR\eaveimrx牀憉僒}zxɽv˽t˽u̼uͺuθuθuθuθuθuθuθuθuθuθ(8#H;TR[e`vdhlqu}劆䆐ポ‬}zwwʿw˽w̻w͹w͹w͹w͹w͹w͹w͹w͹w͹w͹(8#H;TR[e_vcgkosz厃㋎⇛߁{y¾yy˾y̻y͹y͹y͹y͹y͹y͹y͹y͹y͹y͹(8#H;TSZe^vbfimqw䓀␋ވل|Ǿ|ĸ{{ʾ{̼{͹{͹{͹{͹{͹{͹{͹{͹{͹{͹(8#H;TSYd^ubehlos|ᖇߒ܎Ά̿ʷŲ~¯~ʿ}̼}ͺ}ͺ}ͺ}ͺ}ͺ}ͺ}ͺ}ͺ}ͺ}ͺ(8#H;SRYd]uadgkmpxݚٖÈҷ˱Ƭ©ʿ˼ͺͺͺͺͺͺͺͺͺͺ(8#G;SRXc]t`dgjkmsߨ~ۤԡ׺կͪǦä˽ͺͺͺͺͺͺͺͺͺͺ(8#G;RQXb\s`cfijln޶xض͵氛קΣȡğ˽̻̻̻̻̻̻̻̻̻̻(8#G;RQWb\r`cgjklmqжܨנϝɛŚ™ʾ̼̼̼̼̼̼̼̼̼̼(8#G;QPW`\p`dhmomaqûĀ̪ա֚ϗʖƕÕʿ˽˽˽˽˽˽˽˽˽˽(9#G;QOV_[n`|eklaTcq°~ɢŽϗѕΒʑǑđʾʾʾʾʾʾʾʾʾʾ( 9#G;PNV][kbxkl\HWep|śŊɒĞ̏ĹˍɌnjČʿʿʿʿʿʿʿʿʿʿ( 9"G7BFFRJ\Nc{RiuVmpZql^sjcugfwejycnzar{`u|_y}]~~\ZZZZZZZZZZ۲*3 8/>PKVX[e_pczgjkҽcƲlxś̖Ǖ˽ͺθ϶ддддддддд! 1A0H=PJWV]abkfslxo{X_htɍǎʾ̻͹Ϸеееееееее ! 1@/H;QGXS_]edmioiZzU\dpņćʿ̼ͺθ϶϶϶϶϶϶϶϶϶ ! 2?.I9RDZNbVkZmZVnROU_l΀̠ʿʾ˼̻ιηηηηηηηηη ! 2>,I6S@]GgLjJV`StNLO[k}~ϕ|ε|̼~˼̼̻͹θθθθθθθθθ  2?*J2U:a=g4ACEOIXM`xRfrVjm[ni`qfesdjuaow_tx]zz[{Y|W}V~UUUUUUUUUַ+4 9/>;CE|HMuMSoRXjV\f[_c_a`cc^ge\kgZphXtiVykTlSmQnPoPoPoPoPoPoPoPoPo٬ # ,2'91w@9pF@kLEfPIbUL_YN\]QZaRWdTUhUTlVRoXPsYOxZM|[K\J]J]J]J]J]J]J]J]J]̹  #{+r4%k<+eB1`H5\M8YR;VV=TZ?R]@P`BNdCMgDKkFJnGHrHGvIE{JDKDKDKDKDKDKDKDKDKu l"e,_5[=#VD(SJ+PP.MT0KX2I\3G_5Fc6Df7Cj9Bn:@r;?v<={=<><><><><><><><><>xvv0tA%pP4rYBs`OqgZnndkvlh~sexb|_][YWV‰T̊SًS݌UߌVXYYYYYYYYxvv0tA%pP4rYBs`OqgZnndkvlh~sexb|_][YWV‰T̊SًS݌UߌVXYYYYYYYYxvv0tA%pP4rYBs`OqgZnndkvlh~sexb|_][YWV‰T̊SًS݌UߌVXYYYYYYYYxww0uA%qP5uXBv_Ouf[qlentmj|tgzda^\ZYWŒU΍TێVݏWߏXZ[[[[[[[[yxx/v@%tO5xVCy]Pxd[vjfqqonyvj|gda^\ZXĐWБWڒXݒZ[]^^^^^^^^zyy/w@%wM5{TC}[P|b\yhgunpqvxm~~jfc`^\ZƓXԕYڕ[ݖ\_`````````{zz/x@%zL5SCZP`\}fgylqtryp{lieb`][ȗZ֘[ڙ]ޙ`abbbbbbbbb{{{.z@&}J5QBXP^\dh~jrypztwplhea_\˚\֜^ۜaߜbߝcߝdߝeߜeߜeߜeߜeߜeߜeߜeߜ|{|.{?&I4PBVO\\bhgr~m{xss|okgc`]ў_֟aܠdݠeݠfݠgݠhݠhݠhݠhݠhݠhݠhݠhݠ}|}.|?&G4NATOZ[_gerj{~pxwsniea`Ңb٣eۣgۤhۤiۣjۣjۢjۢjۢjۢjۢjۢjۢjۢ~}~.}?&F3M@SNXZ]fbqg{l}sw}rmhdcӦf٦h٧j٧k٧l٦mڥmڥmڥmڥmڥmڥmڥmڥmڥ~~->&E2K?RLXY]eapezjp}xwqlhf֩j֪l֪m֪nתoةpاp٧p٧p٧p٧p٧p٧p٧p٧-=%C2K>RKXW\c`ndyhmu}wplkҭmԭoԭqխrլr֫rשsبsبsبsبsبsبsبsب -<%B1K=RIWV\a_lcvfjqڅ{}uqo˰qӰsӯtԮuԭuլu֪uתuתuתuתuתuתuתuת -;$B0KI'L;LML]MiOtS}{Ysbmnh|d匔a䢖`㿗`ޗcdfgggggggg &--'>F,I?IOJ\LgOp}Uwu[}ncilewaꃋ_铍\觏[Zޏ__````````,=C/E?GMIYLb}QivVoo\tjcxfk{bs~_}\YWVUՆXZZZZZZZZ- :?/B=EIHS|MZuRanWei\iecmaio^pr[wtXvVxTyRzQ{P{O|O|O|O|O|O|O|O|ܩμ+5;,?8BByHJrMPlRUgWYc\]`b_\gbYldWrfTygRiPjNlMmKnKnKnKnKnKnKnKnKnϴ% /5&~;0u@8nF?iLDdQH`VK][NY`PWdRTiTRnVOtWMzYKZI[G]F^E^E^E^E^E^E^E^E^Ҭž (y/p6&j=,dD1_J6[O9XTR]@OaBMeCKiEInFGsHExID~JBK@L?M?M?M?M?M?M?M?MƷ ~t k(c/]7X?#TE'QK)NP,KT.IX/G\1E_2Cc3Ag4@l6>p7Q =U!;Y"9]#8b%6f&5k'3o(2t)0z+/~+/~+/~+/~+/~+/~+/~+/~+li! f.d?bM(fU3g]?eeIbnR_xY\_XdUhSkQmOoMqLrJsItGuGvIvKvMvOuOuOuOuOuOuOuOuli! f.d?bM(fU3g]?eeIbnR_xY\_XdUhSkQmOoMqLrJsItGuGvIvKvMvOuOuOuOuOuOuOuOulj! g-d?eL(iT4j\?hdJelSbuZ^`[fWjUmRoPqOsMuKvJwHxIxKyMyOxQxRxRxRxRxRxRxRxmk h-f?hJ(lR4mZ@lbJhiTes\a|b^hZlWoTrRtPvOxMyKzJ{L|N|P|R{T|T|T|T|T|T|T|T|nl i-g>kH(oP4qX@p`KlgThp]dydai]nYrWuTwRyP{N|L~L~NQSUVVVVVVVVomj,h>nG(sN4uV@s^KqeUll^hvedk`p\tYxVzT|R~OˀN܁OQTVWYYYYYYYYpnk,i=rE(wL4yT@x[KubUqj_lrfh{mcr_w[zX}VSQ΄O߅RTWYZ[[[[[[[[pol,l<uC'{J3}Q?}YKz`Uvg_qnglwngtcy_}[XVṪR߉UXZ\]^^^^^^^^qom+p:yA'H3P?XJ^U|e_wkhqrom|vh{d`]ZXɋVލX\]_`玽a莼a莼a莼a莼a莼a莼a莼arpo+s8}?&G2O>VI]Tc^}ihxoprxwm}ida][ƏZݐ]_a咿b咻c咷d摶d摶d摶d摶d摶d摶d摶dsqp+v6=%G1NWG[Q_Zޞbc֖hpύp|ȅw~xspoǢpܡqݠrޞrߝrr᚛rᙛrᙛrᙛrᙛrᙛrᙛrvut)1;D(K1R:WCZLߩ]T٥_`Мfoɓm|t|}xvu£uۣvܡvݟvޞuߜuuuuuuuuwvv(0:C&K.Q7V>ZEܲZNӫ]_ˢcnÙj{qy|{{ۤ{ܢzݠyޞyߝxxxxxxxxwvx'0:C$J+P2U8߹Y=׸TLΰ[^ƨamgznvڤۢ~ݠ}ޟ|ߝ{{{{{{{{x wz% /9B!I'P,T0R7ҽRKɶY\_leyks|ڤܢݠޟߝ~~~~~~~x x}$ .8AH!N$S%G5PIļWZ]jbwipy}xvۣzܡ}ݠޞߜy y# -7?FLEE3NGTXZh`ufmv~vqn٠rݟuޞxߝz||||||||z z" ,5=CE 7C0LDRUWd]rc}jsvojh֛kߜnqsuvvvvvvv| {!* 2 8 8-<B-I@OQU`Zm`xgxpp|iŽdêbՕdgjlnooooooo} }&+*3 BI,K>NNS\Xh^rze{qoj{dӍ`թ^Ӎ^`beghhhhhhh 6B G2JBMPP\TfyZnqbujlzdx^刂Z栅WņX[\^````````$8A%E5ICLOPYzTarZhjamdjr^tvYyU{R}Q~T~W~XYYYYYYYY Ѹ(7?'D5HAKKzPTrTZjY`e`d_hhZqkV|nRpPrNtLuMuQtTuTvTvTvTvTvTvTvүȿ ( 5<'A3F=xJEpOLiTQcYV^_YZf\Vm_SvbOdLfJgIiGjFjJjKjKjKjKjKjKjKjԦɸ& 18#}>-uD5nINa@LfBIlDFsFDzHAI?K>L=M;N;N;N;N;N;N;N;N̫|s% k-d5^; XA$SG(OM*LR-IW/F\1Da2Bf4?l5=r7;y89:7;6<5=4>4>4>4>4>4>4>x ne ]& W-Q4L;HAEFAK?P6C4G1K/P-T+Y)^'c&i$o"t!| } } } } } } }_\% W1 Q>UIYR&YZ0Xd9UnARyGNMKQHTFWDYCZA\@]>^=_<`;`=`?`A`D`E_E_E_E_E_E_E_`\% W0 R>XH\P'\Y1Zb:WlBTwHPNMRJVHXF[D\B^A_?`>a=b[F_N'`W1]`;[jCWtJS~PPTLXJ[H]F_DaBbAc?d>e?eBeDeFeIdJeJeJeJeJeJeJea^$ Y/ U=^DbM'cU2a^;^gD[qKW|QSVOZL]J`HbFcDeBfAg@hBhDhGhIhKhMhMhMhMhMhMhMhb_# Z/ Y;bBfK'gS2f\\HbRh[{qdvylpskygca_‡_و`눶b눱c눮d쇫e솨f텨f텨f텨f텨f텨f텨figh& v+5>F(M1T;YE_N߈fXڃna|vlu}tp{kheccӌd錮f鋩gꊦhꉤi눢i솢i솢i솢i솢i솢i솢ijhk$ y*4=E%L.R7W@\JڐdT҈kárl{zuu}pljhgϏh玥j荢k錟k鋞lꉜl눜l눜l눜l눜l눜l눜lkim# {) 3<D"J*P3U;ܝZDԕaS͎hadžolwvz~~uqnmlˑm搝n珚n荙o錘oꊗoꉗoꉗoꉗoꉗoꉗoꉗokio! ~( 2;BI&N-ަR5֣VCϛ^Rȓf`mltv{~{wtrqǓr咔r搓r玓r荒r鋒rꊒrꊒrꊒrꊒrꊒrꊒrljr ' 19AG"L'ۮM/ҨTAʠ\QÙd_jkqux~|ywwÔx响w摍v珍v莌u錌uꊌuꊌuꊌuꊌuꊌuꊌumkt& /8?D߲H ֳH.έR@ƦZPa^hjntu}}~}~㓅|咆{搆z莇y錇x鋇x鋇x鋇x鋇x鋇x鋇xmkv% . 5<A۹BѷF,ɲP>XN_\eilsr|z|{}搀~莁}茂|鋂|鋂|鋂|鋂|鋂|鋂|nly#+ 3 8߹;7ͼD*ŷNSKYW_axeiqmpjvvdŃz_Ɣ}[ưYY\^`bbbbbbbt  ۤѴ0 <D)K8QEWPy]Yqdajlgdul_ւpZ֓sWٯuVtTwUyWzY{[|[|[|[|[|[|[|w  ҫʺ2=D,I8OCwTLpZSjaYdi_^rcZ~gUiRkOlNlQmRpSrTsTsTsTsTsTsTszբ˲$3< C,I6wN?oSFhYLc`Q^gUYoYUy\P_LaIbGcHcMcNeOgOgOgOgOgOgOgڙ̫º$1:|A(tG1mM8gR>aXC]^GXeJTlMOuPKRGUDVAX?Y@YEYIYIYIYIYIYIYIYߑΤõ".x7q>"jE)dK/^P3ZV7U\;Qb=Mh@IoBExEAG=H;J:K8L7M:M:M:M:M:M:M:Mҝůzr) k2e:_AZG$UM'QR+MX-I]/Ec2Bi4>q6;z7795;3<2=1>1?1?1?1?1?1?1?Ǫvme$ ^, X4S;OAKGGLCR@W!<\#9b$6i&3p'0x)-++,*-).(/(/(/(/(/(/(/|qh `XR& L- G4B:??;D7I4N1S.Y,^)e&l#t!}|mcZR KD?% :, 61 16 -; *?'D%H"M SX_els{SN) H5 D?HDLMMW#Kb+Hm2Ex8A<=@;C:E9G7I6J5K4L4L3M2M2M4M7M9M;LAB?E=GO?O?O?O?O?O?OUP(J4 I;O@SJTS$R]-Ph4Ls:I~?EDCGAI?K>M=N;O:P:Q9R8R7R:RWGYQ%W[-Tf5QqS=TYtDU~IRNOQMTKVIXHYF[E[D\D\D\F\H]J^K_L_L_L_L_L_L_YT&P0 Y0 a7gAiK%iT.f]7bf?_pF[zKXPTTRWPYN[L]K_J`I`H`I`JaLcNcOcPcPcPcPcPcPcZV%T- ^- f5l?oI$oR-m[6ic?elFavM^RZVWZU]S_QaOcNdMdMdMeNgPhRhShThThThThThTh[W$X+ b+ k3q=tF"uO,sX5p`>khFgrMc{S`X]]Z`WcUeTgRhRhRiQkRlTlVlWlXlXlXlXlXlXl\X$[( f) p1v;zD!{M*yU4v]=reEnnMjwTfZb__c\fYiWkVmUnUoUpWpXpZp[p[o[o[o[o[o[o]Y#_% j' t0{9BJ(R1}Z;yaDujLpsTl|[gacf`j]n[pZrYsYtYt[u]t^s_s_r_r_r_r_r_r]Z#b# n& w. 7@H%P.W7^A|gJwpSqx\mchiembq`t^w]x]x]x_xawavbucucucucucucu^["e q% {, 5>F!M*S3݈[=փdH|lSwt\r|dnkjpgtdxbza|a|b|c{dzexfwfvfvfvfvfvfv_\"ht$~+ 3<CI%ߒP.؎X9шaG˂jS|q]wxeslorkvizg}fef~h}h{iziyixixixixixix`]!jw") 1 9@F ۙL(ҔV8̍_FƇgSn]|uex|mtspxm|kjjЁk쀗ll}l{lzlylylylylyly`^ my!'/ 6=ޠB֞H'ΙS7ǒ]EdRl\re}ymysuyr}poo̓pꂏpp~p|o{ozozozozozoza`o| %, 3 8ۧ<ңF%ʝQ6×ZDbQi\pevm~~s{yx~uttʄu郈uts}s{s{s{s{s{s{s{bbr~")/ ߧ3 ֬7ΨE$ƢO4XC`Pg[mdtl{sy}~{zzDžz烁yxw~v|v{v{v{v{v{v{bet%)ܮ*Ұ5ʭC"¨M2VA^NeYkcqkxrx}{yąxz{}|{~}z|~z{~z{~z{~z{~z{~z{cgw׵ ͵2Ų@ K0T?\LbWiaoivq}w~|xtqqsuv}x|x~{x~{x~{x~{x~{x~{dkz۲ ѹɹ0 >I.R=YJ`Uf_lgsn}zuwzq~mjikn~p}r{r{r{r{r{r{r{en~ תѶ˾ÿ- ;G+P:WF^Rd[jd}pkvxqpvkzf}c~b}d}g|i{kzlylylylylylyfrءЮ˺)8D'M5UB[MaW}g_vnfpvljqeu`x]x\x\y_xbxdwewewewewewewhx ۘѦʳÿ %5A"J0R=YG~_QweXpl_jted~j_m[pXqWpVrXs[s]s^s^s^s^s^s^sk~Ӟʬù0=G*O6~V@v]IpcPjjVdr\_|`ZˉdV˜fT̷gSgPiRkTlVmWmWmWmWmWmWmr̥ؖó/ ;D$}L/vT8o[@ibGdiL_qQZ{UV܈XSݚZP޴[O[M]M`NbPcPdPdPdPdPdPdzގϞŭ!0;zC#sJ+lQ3fW9a^?\fCXnGTwKPMMPJRHSGSHRIUJWJXJXJXJXJXJXҗǨ#~/ w9pAjI&dO,^V1Z\5Vc9RjI@IDHEIEIEIEIEIEIِɢy"q, k6e>`E[L"VS&RY*O_-Kf/Gm2Dv4@6=8::8<6=5=6=8=8=8=8=8=8=̜{sle) _2 Y9UAPGMNISFY B`"?f$L;Q8W5^2e/l+u(%$" ! " " " " " "wiaY RLF&A- =3 99 5> 1C .H*M'S$Y!`hq{wh\TLE >94$/*+/&3#8 < A F L R Y a i r{G#A-98 ;< >A?H@T?`=l%:w)7-514335261809/9/:.;.;-;-;,;,;-:/:1:1:1:1:1:1:G"B-:8 >; A?BFDRC^Aj&>u+;/927567584:3;2;2<1=1=0=0>/=/=0<2<4=4=4=4=4=4=H"B-;8 A9 E=GEIPH\ Eg'Cs,@~0=4;7:99;8<7=6>5?5?4@4@3@3@3?3?6?8@8@8@8@8@8@I!D,>6 E7 I;MCNNMY!Kd(Hp-Ez2B6@9>;==B@AB@C?D>E=F=FJAHCFEEGDHCIBJBJAKAJAJ@LBMCNENENENENENENMH*K- S, Z3 _<aFaP"_Z*[d1Xo7UxX}CVFSJQLPNNPMQLRLRLRKTJVJWLXMXOXOXOXOXOXOXOJ(T&]' e. j7mAnJlS(i\0ef8bp>_yD\IYLWOURSTRUQWPXPXOZN\O\Q\R\S\S\S\S\S\S\PL'X#b%j, o4s>tGsP&pY/lb7il>euEb~J_O\SYVWYV[T]T^S^S`SaTaUaW`X`X`X`X`X`X`QO%[ f#n* t1 x;zDyL#wU,t^5ph=lqEhyLdRaV^Z\]Z`YbXcWdWeWeXeZd[d\c\c\c\c\c\cRR"^j"r(x. }7@H ~P({[1veJ(S5[AcKiTp[vb}glp{~sw}uu}uu}sv|qx{pyynzxlzxlzxlzxlzxlzxlXfu ٘ԢͩŪ- <H&Q3Y?`IgRmZt`{f}kxotrptntnspqros~nt}lt}lt}lt}lt}lt}lYi x ۑӜΦȭ*9E#O1W=^GePkWq^|xdwiqmmpjrhrgqipkommnlnlnlnlnlnl\m |ՕΠȪ²'6C L-U9\CbLiT{oZvv`p~ekjgmcoao`oandmflhkhkhkhkhkhk`qڎКɥ¯ #3@J)R5Y?`H{fOumVot[j|`eeah]j[jZjZj]j_iahahahahahahe vӓʟ«/ <G$O/W9{]BtdIokOirUdzZ_^[aXcVcUcSdVeXeZdZdZdZdZdZdk|ً͙Ħ*8CL)zT2s[:nbAhiGcpL^yQZƒTV‘WS¦YQYPYN\O]Q^S^S^S^S^S^S^rВơ $3 ?xH rQ)lX1g`7bg=]nAYwFUЂIQѐLOѥMMNLMIQISKULVLVLVLVLVLVz֋ɛz/ t:nDiM!dU(_]-[d2Wl6Su:P=M@JAHBGBECCFEHFJFJFJFJFJFJބ͕{u"p/ j9dB_JZQ WY$S`(Ph,Lp/Iy1F4C6A8?9=9<9>9?UFRMNTK[Gb Dj"Ar%>}';)9+6-5-3.2.4.4.4.4.4.4.Ǜtjd^Y)T2 O9 K@GGDN@T=[;b8j4s1~/-+ )!("'"'"'"'"'"'"rf^XRL$H,C3?: ;@ 8E 4K 1Q.X+_(g%q!| rdXQKE@;%6+21.6*;&A #F L S Z c l w sdVLD>8 2-)"$',05: ? ELS\ e p z :&31-9 2: 4? 3G 3R3_1k/v-,"+$*%)')'((()()'*'*&*&*&*&*&)&(&)%)%)%)%)%);&400758 7= 7E 8P7]6i3t1!0#/&.'-(,),*++++*,*,*,*,),),)+**),(,(,(,(,(,<&504596 ;: 4 @8 C@ CKCWAc?n =y$:(9*8,7.6/5051414232323232312213142525252525>%8/=/B0 G5 J> JHJTH_Fj"Cu&A*?->/=1<2;3:4:59596868685857769798:8:8:8:8:?$9.A,H, M2 Q; REQPO[Mf#Jq(Hz,F/D2C4B6A7@8?9?9>:>:>9>9=;<=;>=?>?>?>?>?>?A#=,F(M(T0 X8 YBYLWWTb$Rl*Ov.M2K5I7H9G;FD=D=C?BBACADCDDDDDDDDDDDB#A)K$S%Z- ^5 _>`I^S[]$Xh+Vr0S{4Q8O:N=L>K@KAJAJBIBICGFGHFIGIIIIIIIIIIIIIC"E%O!X#`*d2 f: gEeObX$`c+]m1Zv6X:U=S@RBPDOFNGMIMIMJLLLMLNMNNMOMOMOMOMOMD!I"S]!e(i/l7 m@lJjT"g_*di0ar6^{<[AYDWGUJTLSNROQPQPQQQRQRRRSQTQTQTQTQTQE!LWbi%n+q3 s<sEqOn['je0gn8cv?a~D^H\KZNXQWSVTUUUVUVVVVVWUXTXTXTXTXTXTF O[fm"s(w/y7 y@xLtW'pa1lj9ir@fzFcKaO_R]U\WZYZZYZZZZZ[Y\X\W]W]W]W]W]WG R^iqw${*2 ܀;~HzT&v^1rg:noAkvGh}LfQdUbX`Z_\^^^^^^_]_\`[`YaYaYaYaYaYHUblt{ %+׆7 σEQ%{[0wd:slBpsHmzNkRiVfZe]c_babacac_d^d\d[dZdZdZdZdZIWdox~܉$Ҋ4 ˇCăN$Y/|a9xiBupHrwNp~SmXk\i_hagcfdgchah_h^h\h\h\h\h\h\KZgrz׎Ύ2 nj@L#V/_9}gAznHwtOt{TrXp]n`lckekekdlclal_l]k]k]k]k]k]M\jt} ݌ ґʒ/Ð>J"T-]8d@~kH{rNyxTwYt]raqdpfpfpfpdpbp`o^o^o^o^o^o^P^ l w ڈՐΕƖ-<H R,Z6b?iGpN~vS|}Yy]wavd}ufztgyufyudzub{t`{s_|r^|r^|r^|r^|r^Rao z܃ՌГəš*:FP*X5`>gFmMtS{X\}}`y|dvzftzgrzfszdtzbuxavw_vv^vv^vv^vv^vv^Udr}؆Џ˗ŝ(7CM(V3^H"Q-Y6`>fEymKttQo{VkZf^c``a_a_`__b^d]d]d]d]d]d]_o}҉ɓ-;EN)V2~]:xdAskGnqLiyQeU`Y][Z\Y\X\X\[[][^Z^Z^Z^Z^Zdtق͎ę)7BK#}S,w[4rb;lh@hoFcwJ_O[RWTUUSURVQWSWUWVWVWVWVWVWjz҈ǔ #2 >{HuP%pX,k_3ff8am=]uBYFUIRKPLNLMMKOLPNQOQOQOQOQOQqځˏ~,x9 rDmMhU#c\)_d.[k3Ws7S};Pȉ>Mș@KɯAJAIBFEEFGHHHHHHHHHHHyЉĘ}uq$m2i> dH`Q\YXa#Ti'Qq+M{.J؇1Hٗ2Fڭ4E4D4A8?:@ KF HNEVB]@e=n:x85320 / / / / / / / š{ncYUPL(H1D9@@=G :N 7U 4\1d.n+y)(&%#""""""|naUNI D@#<*82480>-D*J&Q #Y a k w   }n`SHB<73/#+)&."39?EL T ]gs o_QD<5/*% #( -28>EMValx.*$4%6(8(= &E &Q %] $j#u"!!   /*%3)4,6,: ,C ,O +[ )g(s&}&%%$$$###"""""""!     0)'3-20317 2A 2L 1X0d.o-z,+**))(((''''''&& %!%!%!%!%!1)*12/6074:> :I 8U7`5l4v2100/ /!.!."-"-"-"-"-"-!-",$+%*&*&*&*&*&2(/.7+;,?2B< AE @Q?]=h;r9|87!6"6#5$5%4%4&4&3&3&3%3%2(1)1*0+0+0+0+0+4(4*<'@'F/I9 JB HLGXEcCnAx?">$=&<'<(;(;):):*:*:):)9,8.7/7071717171715'9'@#G$M,P5 Q> PHNSM_JiHs!G|$E'D)C*B+B,A-A-A.A-A-@0>2>4=5=6=6=6=6=6=66&=#EN!T)W1X: XDVNTYRePo#Nx'L*K,J.I/H0G1F2F3E4E4E7D9C:C;C;D;D;D;D;D;7&A JSZ&]-_6 _? ^J[UY`Wj$Us(S|,Q/O2N4M6L8K9K;J;JP@OAOBNBNCNDNDNDODPCPCPCPCPC=!IS]dh%k,l5l> jLgWda&bj-_s2]z7[;Y>W@VCUETFSHSHSHSISITHTGUFUFUFUFUF@LWahm!p'r.r: pGmSj^&gg.eo4bv9`}=^A]D[GZIYKXLWMWMXMXLYKYJYIYIYIYI}ICC_PROFILE YICO[elqt w'x6vDsPpZ&mc.jk5gs;ey?cCaG`J^L]N\P\Q\Q\P]O]N]L^K^K^K^K^KER ^ hotx| |3zAxMuW&r`.oh5lo;jv@h}EfHdLcObQaS`T`TaSaQbPbNbMbMbMbMbMGT a j r w | Ҁˀ0>|KyU%v^.sf5qmoC~uHz}MvQrTo~Wl}Xj}Xj}Wj}Uk}Tl{RmyQmyQmyQmyQmyQVeq{̄Ō/<GP%X._5f;}lAxsFtzJpOlRhUfVdWcVdTdSfRgQgQgQgQgQZhuȈ,9DM"U*]2{c8vj>rqCnxGjKfObR_S^T]S]R]Q_PaOaOaOaOaO^mȳÎ'5 AJS&zZ-ua3ph9ln>hvCd~G`J\MYOXOWOVOVNXNZMZMZMZMZMcrNJ "1=}GxO sW'n^-je3fl8at<]|@ZDVFTHRIQHPIOJPJRIRIRIRIRIix̅,z8 uCpLkT g[&cc+_j0[r4Wz8T;Q>N?L@L?JAIBICJDJDJDJDJDpŌxu$p2l> hHcP_X\`!Xg&Uo*Qx-N0K3I4G5F4E7C9A:C;C;C;C;C;xʇvkge*a7^B ZKWTS\PdMlJu!Gπ$Eώ&BϠ'Aк(@(?*=-;/;1;1;1;1;1Ђ‘vkaX VT.R:ODLN JV G_EgBq@{=;98754!3#3#3#3#3#ƍvj_UN LI*F5C>AF>N&;/875>2F/M-U*^'g $r "          wi\PE>: 62 /(+/(5$<!BIQZeq ~ yi[NB82-) %!%*06 =DLVam{{k[M@4+%   $)/6=FP[gu-545:CO\ h s ~                      -3!1"2!7 A MY e p {    ", 0%.'/&3(>'J &V $b #m !x ! !!    #,%-++-,.10;/F .R ,^ +i )t )}((''''&&&&&&&%%$#####%++)0'3'7.988C7N 5Z 3e2p1y00//...------,+++++++'*/&5#9#?+A5A??J >U <`:k9u8}7766555555543 2"2#2#1$1$1$1$+(4":A F(I1I;HE FP D\CfAp@y?>>==<<<<; ;!:$9'9(9)8)8)8)8)8)/%9?HM%P-Q6P@ NK LVKaIkHtF}EE D"C#B$B%A&A'A(A(@+@-?.?.?.?.?.?.?.3"=DNS!V(W1W;UE TQS]QgOpMx L#K&J(I*H+H,G.G.F/F/F1E2E3E3E3E3E3E3E37AJSY\$^+^4]? \LZXXbVk Ts$R{(Q+P-O/N1M3L4L5K6K6K7K8K8K7K7K6K6K6K6:EOX]ac$d-d9cG `T^^\g"Zo'Xv+W}.U1T4S6R8Q9Q;P;PU?U@T@U@U@U?U>V=V=V=V=V=@KW_ e i kmo1n@ lLiWg_$eg*co/av3`|6^:]<\?[AZCYDYDYDZCZBZ@Z?Z?Z?Z?Z?CNZbhlors.s= qInTl]$jd*hl0fr4ey8c;a?`A_D^E^G]G]G^E^D_B_A_A_A_A_AEP]ekosvx+w: uFsQqZ$nb*li0kp5iv9g}=f@eCcEbGbIaIbIbGcEcDcBcBcBcBcBG S_gnsvy{({8 yDwNuW#s_*qf0om5mt9l{=jAiDhGgIfJfKfJfHgGgEgCfCfCfCfCJVbjqvz}%5~B|LyU"w])ud/sk5rr9px=oAmDlGkJ|jKzjLyjKykIykGzkFzkDzjDzjDzjDzjDLYdmtz} "3?J~S!|[(zb/xi4vo9uv=t}ArE|qHypJvoLtoLsoLsoJtoHtoFuoEunDunDunDunDN\gpw}0=GQ Y'`-}g3{m8zt<}x{@zwDvvGsuJptLntLmtLmtJntHntGosEorEorEorEorEQ^js{-: ENV%^,d1k6{r;w~y?t}Cp|Fm{IjzKhyLgyKgyJhyHhyFixEjwEjwEjwEjwETbmw*7 BLT#[)}b/yi4up9qw=nAjDgGdIbJaJaHaGbFc}Ec}Dc}Dc}Dc}DWeq{ƒ&4?IQ{Y&w`,sf1om5kt:h}>dAaD^F\G[G[F[E[D\C]C]C]C]C\jvƀ 0< EzNuV"q]'md,ik1er5bz9^=[@XBVCUBTBTBTAUAUAUAUAUAap|+|7 wBrKnSjZ!fa&bh+_p/[x3X6T9R;P/>/>/>/>/wŅ|oc][!Y/V:SDPM NV K^HfFpCzAdž>Ȗ=ȫ;;9 8#6$6%6%6%6%ʁ~qeZPKI#G0F;DEBN@W>aJWc n x                      0,*+0;GS_ku~     .)#'$'%.&8%D#P![gqz             *%&(#)#.,/5.@,K+W)b(l 'v '~ ' & & & & & % % % % % % %$$$#####'*".2 7(828;6F4R2] 1h 0q 0z / / /........--,,+++++'$/3:?$@-@7?A=M;X :c 9m 9u8}7776666555543332222, 39AF H(H1G<EFCR B^ BhAq@y?>>===<<<<;; :":":":":":":"08? GLN#O+N5L@LMKY JcHlGtF{EEDCC!B"B#B#A$A%A&A'A'@'@'@'@'@'4< E MQST$T-T:SHRT Q^OgNoMvL}K"J#I%I'H(H)G*G*G+G,G,G,G+G+G+G+G+7@JQ VXYY$[5ZDYPXZVcUkSr Ry#Q&P(O*N,N-M/L/L0L0L0L0L/L/L.L.L.L.:CNUZ\\ _a1a?_L^V\_ZgYn#Xu&V{)U+T.S0S1R3Q4Q5Q5Q4Q4R3R2R1R1R1R1= FRY]`adf-f<eHcSa\`c ^k$]q(\x+Z.Y0X3W5W6V8V8V8V8V6V5V4V3V3V3V3@JU[adfhk)k9jEhPfYe` ch%bn)`u,_|0^2]5\7[9Z;Z;Z;Z:[9[7[6[5[5[5[5BMX_ehjlo&o6nB mMkVi^ he%fl*er-dy1b4a6`9_;_=^=^=_<_:_9_7_6_6_6_6DPZbhlnp s#s3r@ qJoSn[ lb%ki*ip.hv1g~4f7e:d<c>}c?|b?{c>{c<{c:{c8|c7|c7|c7|c7FR\ekprt v w0v= uHtQrYp`%og)nm.mt1k{5j8~i;|h=yg?wg@vg@ug>vgfv?dv@dv>du=eu;et:ft9ft9ft9ft9Q^jsz$2> GP|Wy^$ue(rl-ns1k{4h~8e}:b}=`|>^|>^|=^{<_{:_z9_z8_z8_z8_z8Ucnw~ .: D{MvTs[!ob%li)hp-ex1b5_7\:Z;X;W:X:X9X8Y7Y7Y7Y7Yhs|)|6x@ tIpQlXi_!ef%bn)_v-[0X3V5S6R7Q6Q6Q6Q5Q5Q5Q5Q5_my{x$t1p<lEiNeUb\_d[k#Xs'U}*R-O/M0L0K0J1J1J1J1J1J1J1ftwqmj+g7dAaI ]QZYW`ThQqNz"K%H'F(E(D(C)B+B+B,B,B,B,n{rfa^"\0Z;WDTM QU O]LeImFwDA?>=< ;":#:$:$:$:$vvj]TPN&M2K<IFGOEWB` @i >s;97654321111ŀxk_TI@><&;19<8E7O5Y4b2m0y.ψ-Ϛ+г * * ( (''''{m`TI>5+)(#'.&9%C$M#X"c!p~}n`SG<2)!&/8BL W c po`SF:/%  %-5>HTapqaSE8,!  !(0:DP_n~tcSD6) "*4?L[jz3. -/4>KWdox0 , * +0;HT`ku~ -(&'-8 E Q ]hr{)%""+5AMXcnw%!!"%(%2#<!HT_irz     "$&+.$/--8+C)O(Z'd&n&v&~%%%%%%%%%%%% % $ $####$),367(624=2I1U0_0i0r/y///. . . . . . . . --,,,,,,(.3 :=>#>,<6:B9N9Z9d9m8u 8| 8 7 7766666655444444,29@ CDC$B.B;BIBUB_ Ah @p@w?}?>>===<<<<<;;;;;;06?FI IHG%I5JDJPJZ IcHkGrFyFEDDCCBB B B!B!B!B!A A A A 3 :DJMML NQ1R?RLQV P_OgNnMtL{KJJ!I"H$H%H%H%H&H&H%H$G$G#G#G#6>HNQSRUW,X;XHWR V[UcTjSpRwQ~!P#O%N&N(M)M*M*M*M)M(M'M&M&M&M&9BLQVYXZ](^7]D]O[XZ_YfXmWs!Vz#U%T(S*S+R-R-R.R-R,R+R*R)R(R(R(<FOV[^^_b$c4cAbL`U_\^c]j\q"[w%Z~'Y*X,W.W/V0V0V0W.W-W+W*V*V*V*>IRZ_bcc f!g1g>fI eRdZcabgan#`t&_{)^+].\0[1[2~[2}[2}[0}[.}[-}[,}[+}[+}[+@LU]cfghjk.k;kF iOhWg^fe ek#dr&cy)b,a/~`1|_3z_4x_4w_3w_1w_0w_.w_-w_-w_-w_-BNXafjkkno+o9oC nMmUk\jcii#hp&gw*}f~,{e/xd1vd3tc4rc5qc4qc2qc0rc/rc.rc-rc-rc-EQ\djmooqs(s6sA rJqRpZo`ng#~mn&{lu)xk|,uj/si2ph4nh5mh5lh5lh3lg1mg/mg.mg.mg.mg.GT_hmqssuw%x3w> wHuPtX~s^{re"xql%uqs)spz,po/mn1km3im5gl5fl5fl3gl1gl0hk.hk.hk.hk.JXckquwwz {!|0|<{EzN|yUyx\vxc swi$pvp'mux+kt.hs0es3cr4ar4`r4`q2aq1ap/bp.bp.bp.bp.N\gouz{|~-8B {KwSt~Zq}`n}g"j|n%g{v)ez,by/_y1]x2[x3Zx2Zw1[w0[v/\u.\u.\u.\u.R`ktz~(|5x? tHqPnWk^gddl"at&^|)\,Y.W/U0T/T~/T}.T|-U|,U|,U|,U|,Wfpy|x#u0q;mD jLgSd[ab^i[q!Xz$U'R*P+N,M+M+M+M+M*N*N*N*^kv~xr ol*i6f@cH `P]WZ^WfTnQwN!L$I%H&G%F%F&F&F&F&F&F&er|~phda#_0\:ZCWK TS R[OcLkJuGDBA@?> > =!=!=!=!mywk_XTR'Q3O=MFKNHVF^ Dg Aq?|<:987655555u|odXLF DB)A3?=>G=: < ?1A?BLBVA_Ag @n @t?z??>>=====<<<<<<<.4=ADDADG,I;IGIRI[ Hb GiGpFvF|EEDDCCCCCCBBBBB19AGKLIKN'P7PCPNOW O_NfMlLrLyKJJIIH H H H HHHHHH4=ELPRPQT#V3V@VJUS T[SbSiRoQuP|PON!N"N#M$M$M#M!M MMMM7AIQUWVV Y[/[<[GZP YXY_XfWlVrUyU T"S#S%R&R&R&~R%~R#~R"~R!~R ~R ~R 9CMUZ\[[]_,`9`D_M ^U]\]c\i[pZvY~!Y#X%}W'{W(zW(yW(xW'xW%xW#xV"xV"xV"xV";FQY^``_bd)d6dAcK cSbZaa`g`m_t~^|"|]$z\&w\(u[)t[*s[*r[(r[&r[%r[#rZ#rZ#rZ#>JU]bdddfh&h4h?hH gPfXe^ee~dk{cryby"va%ta'r`)p`*n_*m_*m_)m_'m_%m_$m^#m^#m^#AMX`ehhgjk#l1m<lF kNkU~j\{ibyhivhptgw"qf%oe'le)jd*id+gd+gd)gc'hc&hc%hc$hc$hc$CQ\dikkkn pq.q9qC pK |oSynZvn`smgqlnolv!lk~$ij'gi)ei*ci+bi*bh)bh'bg&cg%cg$cg$cg$GU`gmooprtu*u6}u@zuI wtPttWqs^nrelqliqs fp|#do%ao(_n)]n*\n*\m)\m']l&]l%]l$]l$]l$KYdlqrstwyz&{{3w{=tzF qzNnyUky\ixbfwicvqavz!^u$[u&Yt'Wt(Vt(Vs'Vr&Vr%Wq$Wq#Wq#Wq#P^hpvvxz|{~w!t/q9nBkJ hReYc~``~g]}nZ}wX|!U{#S{%Q{%P{%Oz%Oy$Px#Pw#Pw"Pw"Pw"Vdnuz{|ys ol)i5f>dGaN ^U\\YdVlTuQNL J!I!I!H!H I I~ I~ I~ ]is{~|pjec#`/^9[BYJWR TY RaOiLrJ|GECBAAAAAAAdpzvi`[ WU(S3R<PEMMKUI] Ge DoBy?=<::998888lw|pdYOJHF*E5D>BGAO?X=a;j8u 6 4 3 2 1 0/////tth]QG=97 6+443>2G1P0Z.e,p+})'&%%$$ # # # ~yl`UI=3)%#"( 2<FP\hvqdWJ>3( $/9DP]kzΌΣξufWJ=1&$.8CP^m}ߑߩxhXJ=0$ "+6AO^n{jZK<.! '2?N^o~m\L<- ".<L]n+'&',9FS_irz'#!")6BO[fnw~#&2>KVbjsz".9FR]fov}     )4@LXajry $/: F R \ e m t { ! ! (3?KV`hpv}$)) '# *7!E#Q$[%d&k&r&x&~&&&&&&&&&&&&%%%%!#+/.+ ''!+1-?/L0V0_0f0m0t0z00000/ / / / / / . . . . . %*1443.15,7:9G9Q9Z9b9i9o9u8{ 8 8 8 7 77777666555(/6:==9:='?6ABAMAVA^Ae@k @q @w ?~??>>>======<<<+4:AEEAAE"G2H>HIHRHZHa Gg GnFtFzEEDDDCCCCCCBBB.7@GKLIH KM.N;OENONW N^ MdMjLpLwK~JJIIIIIIIHHHH1;ELPQONPR*T7TBTLTS S[ SaRgQnQtP{PON}N{NzNyNxNxMxMxMxMxM4?JQUVTSUW'Y4Y?YIXQ XX W^WeVkVrUy}T{TySwSuRtRsRrRrRrRrQrQrQ7CNUYZXXZ\#]1]<]F]N ]U \\[b~[i{ZoyZvwYuXsXqWoW nW mW mWmVmVmVmVmV9GRY]]\\^ ` a.b:bCaL aS }`Z{``x_fv_mt^tr]}o]m\k\ i[!h[!g[ g[h[hZhZhZhZ=KU\aa``b de+f7fA}fI{eQ xeWvd^sddqckocrlb{jahaf` d`!c`!b`!b_b_c^c^c^c^@OY`ddddghj(j4{k>xjFvjN siU qi\nhblhijgpggyefce`e _e!]d!\d ]d]c]c^b^b^bES]dgghikm|n$yo1vo;soDpoL nnS knYim`gmgdlnblw_k]k[jYj Xj Wj WiWhXhXgXgXgJWahjklmpyrvs st-pt7mtAjtHhtP ftW cs]asd^rl\rtYq~WpUpSpQoQoQnQmQmRlRlRlO\fmnopsxurw nykz(iz3fz=dzEbzL_zS ]yZ [ybXyiVxrSx|QwNwLvKvJvJuJtKsKrKrKrUbkqrsuwyp{j}fc"a._8\AZIXPVW T^ QfOoLyJG~F~D~C~C|C{CzDyDyDy\hqvwxzt}ia\ YW(U2S<RDPLNSK[Ic Gl DvB@>=<;;;;;;cnwz|}{ocZRNL J+H5G>EFDNBV@_>h<";,968?7G6P4Y3c1n/{-+*)((( ' ' ' s~ymaVKA7/,*"),(5'>%H$Q#\"h u}reYNC8.$)3=G S _ l{wj]QE9-" )2=HUbqŁŕĭ~pbSF9,  '1<HVeuՇ՞շtdUF8+$.:GVgywgVG8*   +7FWh{zjYH8) '5EWh{&"!#)6CP[env~#&3?LWbksz".;GR]gov|*6BMYbkrx~ %0<HS]fmtz    *6AMXahou{  " .:GR [ c k q w }  $3@LV^fmsy~#$#  -";$G%Q&Z'a'h(n(t(z((((((('''''&&&#(,.,''+'-5/B0L1U1]1d1j1p1v1|11110000 0 0 / ///"(/586104"618=9H:Q:Y:`:f:l9r9y9 9 8 8 8 8 8 8 7 7 7 6 6 6 $-6=?>:9 <>,@9ADAMAUA\AcAi@o @u @| ? ??>>>>>>== = = (2<CFDA@BE(F5G@HJHRGYG_Ge Gk Fr Fy EEED}D|D{DzDyCyCyCyCyC+7BHKJGFHJ%L2M=MFMNMVM\Mb Li Lo Kv~K~|JzJxJvIuItIsIrIrHrHrHrH/<FMONMLMP!Q.R:RDRLRSRZ R` }Qf {QmyPtwP{uOsOqNpNnNmNmNlMlMmMmLmL2@JQSRQPR TV+W7WAWI~WP|WW zV] xVd vVjtUqrUypTnSlSjShSgRgRgRgQgQgQgQ6DNUVVUUWYZ([4~\>{\Fy[Nw[U u[[ s[a qZhnZolYwjYhXfXdWcWbWbWbVbVbUbUbU;HRYYYYY[]_%|`1y`;v`Dt`Kr`Rp_Y m__ k_fi^mg^ue]c]a\_\^\][\[]Z]Z]Y]Y]Y?LV\\]]]`}byc!vd.td8qeAodImdPjdW hd] fcddckbbs`b}^a[aZ`X`W`W`W_X^X^X^X^CQZ_``ab}dwf thqi*ni5li>iiFgiMeiTci[ ahb _hi]hqZgzXgVfTfReQeQeQdRcRbRbRbHU^bcde}gviqkmmjn&hn1fo;coCaoJ_nQ]nX [n_ Ynf WmoTmxRlPlNkLkKkKjKiLiLhLhLhNZcfghjvlpojqfrcs!`t-^t7\u?ZuGXuNVtUTt\ Rtd Ptl NsvKsIrGrFrEqDqDpEoEnEnEnT`hjkl~nprhubw]y ZzXz'V{1T{:R{BQ{JO{QM{YK{aI{i Fzs Dz~ Bz@y?y>y=x=w=v=u=u=uZfmnpqysmwbzZ~TPN!L+J5I=GEFMDUB]@f>p<{ : 8 7 5 5 5 5~ 5} 5| 5| blrst~vsyh|\SKE B@$>-=62'#,6@LZhxvhZMA4' "+5AN]m~ΓΫ~o`QB3&  )4@O`qtcSC3%%1@QcuwfUE4$!.?Qdx"&3>LXbksz#/;HT^gov|+6COZckrx~  &1>JU^fnty   ,8DOYaiouz%2>IS\djpv{ *7CMW_elqw| !/ < G QYagmsy(6BLT\ciou{"'(% !"#0%<'G(P(X)_)e)k*q*w*}****))))))(((!+01/+( +-+/80B1L2T2[2a3g3m3s2z2222221111000)28973135'739>9H:P:W:]:c:i:p:v:~:99 9 ~9 |8 {8 z8 y8y7y7y7"/9??=:9:=#>0@;@DALATAZA`AfAm@s~@{ }@ {@ y? w? v? u? s> s> r> r= r= r= &5>DCC@?@ CD,F7FAGIGPGWG]}Gc{FjyFq xFx vF tE rE pEoDnDmD lD lC lC lB lB ,9CHHGFDF HJ)K4L>LF|LNzLTyL[wLauLgsKn qKv pK nJlJjJiIgIgIfI fH fH fG fG 0>GKLLKIKMO%~P1|Q;yQDwQKuQRsQXqQ_pQe nPl lPt jP} hOfOdNcNbNaNaMaM aL aL aL 5BKNOOONPR|S"yT.vU8tVArVIpVOnVVlV\jUc iUj gUr eT{ cTaS_S]S\R\R\R\Q \P \P \P 9FOQRSSRU{VwXtY+qZ5oZ>mZFkZMiZTgZZeZacZh aYp _Yy ]X[XZWXWWWVWVVWU WU WT WT >JSUVVWWzYu[ q]n^(l^2j_;h_Cf_Kd_Qb_X`^_^^f \^n Z]w X]V]T\S\Q\Q[Q[QZ QY RY RY BNWXYZ[{\t^o`kahb$fc/dc8bd@`dH^dO\dU[d\YcdWcl Tcu Rb PbNaMaLaKaK`K_ L^ L^ L^ GSZ[\^_uancieegbh _h+]i4\i=ZiDXiLViRTiZRiaPii Nhr Lh} Jg HgFgEgEfEe Ed Ec Ec Ec LX^_`b{cnfgibk]l ZmXn&Vo0To9Ro@QoHOoOMoVLo^JofGopEn{ Cn Am @m ?m >m >k >j >i >i >i R^bcdfvhikanZqUsQtOu Mu+Ku4Jv<HvCGvKEvSDv[Bvc@um>ux;u:u 8t 7t 6t6r 6q 6p 6o 6o Ydfgi{jqlep\sTvLzG{ D|}ICC_PROFILE B|$A}-?}6>}>=}F;~N:~V8}_6}i5}u3}1}/|.|-|-z-x-x-w-w`jklnvokr`uVyM}E<864&3/270?/H.Q,Z+e)q(~&$#""""""hopq|squexZ|OF=4+'%$&"/!8 @JT_kyquvwwxj|^SH>4+"% . 7 ALWdrz{|}}pcWK@5+! &/9CO\jyvh[OC7,  &/9ER`p}n`SF9-! %.9FUevNJǡƻugXK=/!"-9HXi|ޒޫ~n`O?/  +9J[ntcRA0 *:L_r#.<IU_hov|*8DP[dkrx} &3@LV_gnty~  !.;FQZbiouz(5AKU]djpuz"/:EOW_ekqv{ (4?IRZ`flqw|,8CLT[bhmsx    $ 1<FOW]ciou{ "! ,7BJR Y _!e!k!q"w""""""""""!!!'+*(% "%&'2(=)F*N*U+[+a+g+m,t,{,,+++~+}+{+z*z*z)z)&/220-*+-"/.192B2J3Q3X3^4d4j4q4x~4|3z3x3w3v3t2s2s2r1r1r1,5787423 57*859>:G:N;U~;[};a{;gy;nx;uv:~t:s:q:o9n9m9l9l8k8k7k7%2;<=<:9:;=&>2?;}@C{AKyARxAXvA^tAdsAkqAso@{n@l@j@i? g? f?f>e>e=e=e=*7?@AA?>@AC#|D.yE8wFAuFHsFOrFUpF\nFbmFikFpiFyhEfE dE bE aD `D `D_C_B_B_B/;CDEEDCE}FyH vI+tJ5rK>pKEnKLlKSkKYiK`gKgfKndKwbJ`J ^J ]I [I ZI ZH ZHZGZFZF3@FGHIIG}JxK tMqN(nO2lO;jPCiPJgPPePWdP]bPd`Pl^Ou]O [O YN WN VN UN UM ULUKUKUK8DIKLMM~LwNrPoRkS%iS/gT8eT@dUGbUN`UU_U[]Uc[TjYTsWT} US SS RS QR PR PQ PP PPPOPO<HLNOPQxPrSmUiVfW"cX,aY5`Y=^YE]YL[ZRYYYXY`VYhTYqRX{PX NX LW KW JW JV JU JTKSKSALOQST|UsUlXgZc[`\^])\^2Z^:X^BW^IU^PT^WR^^P^fN^oL^yJ]H] F] E\ D\ D[ DZEYEXEXFQSUVWwYl[f]a_\a YbWb$Uc.Sc6Qd>PdEOdMMdTKd[JdcHdmFcwDcBc@b?b>b>`>_>^>^>^KUWXZ|[s]f`_cZeUfQhOh Mi)Ki2Ji:HjAGjIFjPDjXBja@jj>iupDy6|/,*)('0&8$A#I"S ^iv~|{zzghiktlin^qSuHy@}7.%(09BLW c qlnozporcuWyL}A7.% (1:EP\jystuuvhy[}PD9.%!)2<HTbqyz|{n~aTG;0$ !)3>KYhyufYK>2&  (3?N]n}m_QC5(  &2AQbu؊ף׼ufXI:+  %2CTg{~n`O=,#3EXl,9FQ\dkrx} (5AMW`gnty~ #0<HR[ciouz+7BMV^ekpuz %1<GPX_ekpuz+6AJSZ`fkpu{%0;DMT[aflqv| )4>GOV\bgmrx  !-8BJ Q X ^ c i o u |    &2<EMSZ_ekqy}||{{ "#$!!- 7!@"H"O#V#\$a$h$n$u$}}%|%z%x$w$v$t$s$s#s#s##)++*(%# &())3*<+D+K,R~,X}-^{-dz-kx-rw-zu-s-r-p-o-n,l,l,k+k+k**/111/-,./%1/~28|3Az3Hx4Ow4Uu4[t4ar5hq5po5xn4l4j4i4g4f3e3e2d2d1d1#045664334}6!z7,w85u9=s:Er:Lp;Ro;Xm;_l;fj;mi;ug;e:c:b:`:_9_9^8^8^7^7(48:;;999{:w<t=)q>2o?;m@Bl@Ij@Oi@VgA\fAcdAkc@sa@}_@]@\?Z?Y?Y>X>X=X<X<-9;=??>=z>u@ qAnC%lC/jD8hE?fEFeFMcFSbFZ`Fa_Fi]Fq[E{YEXEVDUDTDSCSCSBSASA2<?ABCC{AuCpElFiH"fH,dI5cJ=aJD`JJ^KQ]KX[K_YKgXJoVJyTJRIQIOINHNHNGNFNFNE6@BDFG|GvFoHjJgKcMaM)_N2]N:\OAZOHYOOWOVVO]TOeROmQOwONMNKNJMIMHLHKHKIJIJ;CEGIJxKpJjMeOaP ^Q&YS/XS7VS?UTFSTLRTSPT[OTcMTkKTuISGSESDRCRBQCPCOCNCN?FIKM}NtOkOdR_T[U XVUW"SX,QX4PX;NYBMYJLYQJYXIY`GYiEYsCYAX?X>W=W^q<^}:^9]7]6]6\6[6Z7Y7XJNPRTtUkW_ZX\R_MaIb FcDc#Bd,Ad3?d;>dB=dJ;dR:eZ8ed6dn5dz3d1c0c.c.b.`/_/_/^PRTVzXoZf[[_TaMdFf@h=j;j9j&7k.6k64k>3kE2kN0kW/k`-kk+kw*k(j&j%i$i%g&f&e&eUWY[u\k^b`VdOfGi?l8o2q /r-r ,r(*r0)r8(r@&sI%sR#r\!rg rtrrqqpnmmlZ\^|_pagb]eRiIlAo8r0u(x"z z{!{){1{:{B{L{W{bzoz~ z yxw v u u t_acvdlfbhWkLoBs9v1y(|  !*2<EP\ix~}}eg}hrigk[nPrEv;{1~( #+4>IUbqlmxnmoarTwI{=2( $,6@MZjzrsttfwY|L@4) #,7CRaqy|zm}_QD7*",8GVgyteWI;-   ,:J[nтње|m^OA2$+<NauufWH9(,?Rf{ )6BNX`hntz %2>IS\cjpuz -8DNW^ekpuz '3>HQY`fkpuz"-8BKSZ`fkpuz '2<ENU[afkpu{!,6@HOV\afkpv| %0:BJQW\bglrx)3=ELRX]ciou}~~~}  " - 7 ?GNTZ_elsz~|zxwvuttt  (2;CJPV}\|b{hyowwvtrqonmllll"$%$#  #".~#7|$?z$Fx%Lv%Ru&Xt&^r&eq&lo'tn'~l'j&i&g&f&e&d%d%d$d$%(*++*(&'|(y**v+3t,;r,Bq-Io-On.Ul.\k.bi.jh.rf.{e.c.a.`._-^-]-],]+]+!*-/11/.~-y. u/r1&p2/m38l3?j4Fi4Lg4Rf5Yd5`c5ga5o`5y^5\5[4Y4X4W3W3W2W2W1'.13554|3w3s4o6l7#j8,h95f9<d:Cc:Ia:P`:V^;]];e[;mZ;wX;V:U:S:R9Q9Q8Q8Q7Q6,2579:}9w8r8m:j;g<d=)b>2`?9^?@]?G\@MZ@TY@[W@cV@kT@uR@Q@O?M?L?K>K=K<K<L;058;==x=r<m=h?d@aB_B&\C/[D7YD>XDDVEKUERSEYREaPEiOEsME~KDIDHDGCFCFBFAF@F@58<>@|AtAn@gBcD_E [GYG#WH,UH4TI;RIBQIIOJPNJWLJ_KJhIJqGI}FIDIBHAH@G@FAEAEAD9<?ACxEpEhEbG]IYJVLSL QM)OM1NN8LN?KNFJNMHOUGO]EOeCOoBN{@N>Np4t+x"{~  &.8BN[iye|fpgfiYlMpAu6y+}! &/:FSbrkwllm_qRuEz9-! &0<JYj|~rssevW{I</" &1?O`r{yl|]OA3%&3CTg{˒ʮteVG9*  &6HZnl^O@1!&9Mav %2>JT\djpuz"-:EOW_fkqv{)4?IRZaflqv{ $/9DMT[afkpuz)4>GOU[afkpuz #.8AIPV[aejou{(2;CJQV[`ekpv~",5=EKQW\aflry %/8?FLRX]bhov~|zyxwvvv )2:BHNTY~_| e{ ly tw }v t r q o n m m m m   "-5}={DyJxPvVu\sbripqnzmkihfedddd }y(v1t9r@qFoLnSlYk_i fh nf wd c a _^]\\\\"$&&%~${!x u"r#$o$-m%5k&<i&Ch'If'Oe'Vc(\b(d`(l_(u]([(Z(X'W'V'U&U&U%U%#')+,}+x*u(q(n)k* h+*f,2d-9c-@a.F`.L^.S]/Z[/aZ/iX/sV/}U/S.Q.P.O-O-O,O,O+#'+.00x0s/o.k.h/e1b2'`2/^36\3=[4CY4JX4PW5WU5_T5gR5qP5|N5M4K4J4I3H3I2I1I1'+/24{5s5o3j3f4b5 _6\7#Z8,X83W9:U9AT:GR:NQ:UO:]N:eL:oJ:zI:G:E9D9C8C8C7C6D6*/257w8o9j7e8`9\:Y<W< U=)S>1Q>8P>>N?EM?LK?SJ?[H?cG?mE?xC?A>@>>>===<>;>;>:.269}:s<k<e<`<[>W@TAQBOB&MC.KC5JC<IDCGDIFDQDDYCDbADk?Dv=Do?g@a@ZAUCQENF KGIG#GH+FH2DH9CH@AIG@IN>IV=I_;Ii9It7I6H4H2G1G1F2E3D3C59=?uAlCdD\EUFPHKJHK ELBMAM'?M/=N6EKQV[`ejqx'08?FLQV[`fls|~}|{zzz !*3:AGLRW\~b|i{pyxxvtsrqppoo$-5}<|BzHxNwSvYt_sfqmpvnlkihgfeee  }z(w 0u 7s >r Dp Jo Pm Vl]jdikgte~db`_ ] ]\\ ] }zy ur#o,m3k:iAhGfMeSdZba`i_r]|[YXVUTTTU !"z!urpmjh(e0d7b =` C_!J]!P\!WZ!^Y"fW"oU"yT"R!P!N!M M M MM!%'{'t'p%l$j"g#c$a%$_&,]'3[':Z'@X(GW(MU(TT)[R)dP)mN)wM)K(I(H(F'F'F&G&G%!%)+v,o,j+g)c)`* ]*[+!X,)V-0U-7S.>R.DP.KO/RM/YL/aJ/kH/uF/E.C.A.@-@-@,A+A+ %)-{/r0k0e/b.^.Z/W0U1R2&Q2.O34M3;L4BJ4HI4OG4WF4_D4iB4t@4?4=3;3:2:2:1;0;0#)-0x2n3g4a4]2X4U5R6O7M7#K8+I82H98F9?E9FC9MB9U@9^>9g<9r;9~9978584746565564',03t6k7c8]8X7S9O:L; I<G< E=(C=/B>6@>=?>C=>K<>S:>\8>e7>p5>}3>1=/=.<.;/:0:09+/4|7p9g:_;Y<S<N>J?F@CAAA?B%=B,*>.37x:m<c>\?U?MAHCDD@E0IF/IN-IW+Ia)Il'Hy%H#G"G F E!D"C#C37;t>i@`AXBQCHFBH=I9K5L 2M0M/N%-N,,N3*N;(NC'NK%NT#N^!NjNwMMLLKJIH7;~?pAeC\ETFMGDJ>L9N3P-R)S'T%T!$T("T/!T7U?UHUQU[TgTtSSR Q QOON<@yClEaGXHQIIKAN:P3S-U&X Z[[[#[+[2[:[C[M [X [cZpZYXWWVUTAEtHgJ]KTLMMEObHbSb^akaz`_^]\\[G}JnLbNYOQPHR?U7X.\&^ad gijjj j(j0j9jBjMiYifhuhgfedccLvOiQ^RVSLUCX9\0_'cfi knpq qrr"s*s2s<sGrSraqopponmlkSpUdV[WQXF\<_1c(gkn qtwxyz {|}#~+~5}@}L|Z|i{zzyxwvuxYkZa[W\K`?d4h)mqux{~ $-8DRbtq_g`]aPdCi6n*sx| #.;IZkmedfViHn:t-z$1@Pcwkk\oNt?z1" %5FYncuTzE7' );Nbxې۪\M>. -@Uj*6BKT\bhmrx} &1<FOV]chmrw|!,7AIQW]bglqv| '1:CKQW]bfkpv|!+4=DKQW\`ejpv}%.7>EKQV[_ejpw(18?FKPUZ_ekrz #+3:@FKPU[`f~m|v{yxvutttss&.5;}A|GzLyQwVv\tcsjqrp{nmljiihhi | y(w0u7t=rCqHoMnSlYk_ighofxecb`__^^^  | zwtr#o+m2k9j?hDgJePdVc]ae_m^w\ZYWVUUUU ~wsqp m j h &f.d5b;aA_G^M\T[[YcWlUvTRPNMLLMM wqlihf c`"^*\1[8Y>XDVJUQSXQ`PiNtLJHFEDEEE {"r#k#f"c a_\YW 'U .T!4R!;Q"AO"GN"NL"VJ#^H#gG#qE"}C"A"?!>!= > >?!$v&m'f(a'^%[$X$V$S%Q&#O'+M'1L(8J(>I(EG)LE)SD)\B)e@)p>){<(:(9(7'7&7&8%9%$~(r*i+b,]+Y*V)S*P* M+K, I-(G-/F.5D.<C.BA.I?.Q>/Z39=3@;3G:4O84X64a44l23x03.2,2+1*1+0,/-/!'+w/k1b2[3U3P3L3G4D5A6?7=7";7):8088778>59E39M29V09_.9j,8v*8(7&7%6$6%5&4'3%*/s2h4_5W6Q7L7F8B9>:;; 9<7<5=&3=-2=40>;/>B->J+>S)>]'>h%=u#=!=<;;:9 8).}2o5d7[8T9M:G;@=<>8?5A2A0B.B#,C*+C1)C8'C@&CH$CQ"C[ CfCsBBA@@?>=-2y6l9a;X<P=J=C?T?M@FA@B8E2G-I'L!NOOO"O)O1O9OAOK OU O`NmN{MLKKJIH6;p>c@YBQCICCDQe|[nLt={. !3F[qԉԣӾTzD5%&:Oe{'2>GPW^dinsx~"-8BJRX^dinsx~(2<DLSX^cglqw~ ",5>FLRX\afkqw&/8?FLQW[`ejqx  )19@FKPUZ_ekrz$,3:@FKPUZ_emu~}|{zzyyy &.5;AF~K}P{Uz[xavhupsyrponmmmmm }!{)z0x6v<tAsFqKpQnVm]kdjlhugedcbbabb|xvsq$o+n1l7j=iBgGfMeScYba`i_r]}[ZYXWWWX | vrpn kig&e-c3b9`?_D^J\P[WY^XgVpT{SQPNNNMN }tnjh g e b`!^)\/Z 5Y ;X AV GU NS UQ ]P eN oL {J H G E ED D E  wnhca_^\YW$U,S2R8P>OEMKLSJ[HdFnDyB@>=<<== ~rib]ZXWU RP!N(L/K5I;HBFIDPCXAa?l=w;9764566y m"e#^#Y#U"S QN LI G!%F!,D"2C"9A"??#F>#N<#V:#_8#j6#v4#2"0!/!- . /0 u$j&a'Z'T'P&N$K$H%F%C&A'"?')>(0<(6;(=9(D7)K6)T4)]2)h0(t.(,(*'(&'&(%)%*$#q'f)]*V+P+L*I)E*B*@+ =,;,9-&8--6-35.:3.A1.I0.R..\,.f).r'-%-#,", +!*#)$)"|'n*c,Z-S.M.H.D.@/=/:0715132#22*021.38-3?+3G)3P'3Z%3d#3p!2~2110/..%x*j-_/V0O1I1D2?2:3744516/7-7 +7')8.(85&8<$8E"8M 8W8b8o8}7655433$)t-g0\2S3L4F5@5;6491:-;*< '=%=$=$"=+ =2>:>B>K>U>`=m={< ; ;: 9 8 8(-p1c4X6P7I7C8=87:0=,>'@"BCCC C'C/D6D?DH DR C]CiBwBA@?>==,{1l5_7U9L:E:@;:<3>,A'C!EGI JJ J# J+ J3J;IDINIYIeHsGFFEDCC1v6g9[;Q<I=B==>6@/B'E!HJL OPPPP'P.P7P@PJOUOaNoNMLKJII6p:b=W?M@F@@@8B1E)H"KMP RUV VWW"W*W2W;WEWPV]VkUzTSRQPP{<j?]BSCJCDC;E3H+K#NQT WY[\ ]^__%`-_6_@_L_X^f]v\[ZYXWsBeEYFOGHG?I5K,O#RVY\_acde fghi&i/i:iEhRhagqfecba`lH_JUKMKCL9O.S$W[_behjlmnp qrt u(t3t>sLr[rkq}onlkjfNZOROHP=T1X&\aeiloruvxz{} *6DSc~v}{yxw`TXTNUAX4](bg lquy|!-;J\o^YTYG^9c+hnty~ #1@Rf{[_Mc>h0o!u| %6H\rShDn5u&}+>Riρ̞̺Kt<{, 3I_v$.9CKSZ_ejoty)3=FMTZ_dinsy}ICC_PROFILE  #-7?GNTY^chmry'19AGMRW\aflrz !*2:AGLQV[`fls{$,4;AFKPUZ_fmu '.5;@EJOUZ~`}g{oyywvutsrsss!)/|5z;x@wEuJtOrUq[obnjltjihgfffff}y wus#r*p0n6m;kAjFhKgQeWd^bfap_z^]\[[[[[|vrom kig&f,d2c7a<`B^G]M\SZ[XcWlUwTSRQPPPP{smigec`_!](\.Z3Y9W>VDTJSPQXP`NjLtKJHGGFFG t kea ^ ]\ ZXV#T*R0Q5O;NAMGKNJVH^FhDsCA?>==== yne_ZWVU T Q O M &L ,J 2I 9G ?F FD MBU@^>h<s:8 7 5 4 4 4 5  ti`ZUQONMKIG#E)C0B6@<?C=J;S9\7f5r31/-,,-- ~pe\UPLJHFD B@>&=-;39:8A6H4P2Z0d.p,}*(&$%&'zla!X#Q#L#H"E!C@> < :!8!#6"*5"03"71#>/#F.#N,#X*#b'#n%"|#"!!   vh#^%U&N&H&D&@%>$;%8%6&4&2' 0''.(.-(4+(<)(D'(L%(V#(a!(l(z''&%$$#r"e&Z(Q)J)E)@)<)8)5*2+/+ -,+,*,$(-+&-2$-9".A .J.T._-k-x,,+*)((!o&b)W+N,G,A,=-8-3.//,0)0&1$2#2!!2(2/373?3H3R3]2i2v 1 10/.- -{%k)^,T.K/D/>/9050/2)4%5"67 788%8,848<8E 8O 8Z8e7s6654322#v(g,[/P1H1A2;26213+5&7!9;=>>>! >) >0>8>A>K=V=b=o<~;:9877'r-c0W2M4E4>59545.7'9!<>@BD DDD%D-C5D=CGCRC^BlB{A@?>=<~,m1^4S6I7B7<768/9);">AC EHI JJJ!J)J1J9JCJNJZIhHwGFEDCCx1g6Z8O:F:?:9:2<+>#ADF IKNO PPQR$R,R5Q?QJQVQdPsONLKJIq7b;U=K>C>==5?,B%DGK MPRTVW XYZ['Z0Z:ZEZQY_XoWVUSRQj=\@QAHAAA8B/E&HLO RVX[\^_a bce e)e3d?dKcZbia|`^][[dCWEMEFDGNU[afkpu{ $/8AHOUZ_diou|)2:BIOTY^chnu| "+4<BHMSX\bgmu~%-5<BGLQV[agnw '/5;AFKPU[ahpz~|{zzzxw!)/5;@~E|J{OyUw[vbtjrtpomllklll} {yx#x*u0s6q;p@nElJkPiVh]feeoczb``___``}wspn mlj%i+g1e6d;b@aE`K^Q]Y[aYjXuWUTTTSTT{rmifdba_ ^&],[2Z7X<WAUGTNRUQ]OgNqL~KJIIIIJ}rjd`^[Z XVU"T(R.Q3O8N>LDKJJRHZFdEnC{BA@@??@vk b \ XUTRQOML$J*I0G5F;EACHBO@X>a=l;y9876666~ p e\VQNL L K IGE!D'B-A2?8>?<F:N9W7`5l3x10.----yk`XQLHFED C A ? > $< *:0977=5E3M1V/a-l+y)'% $ # # $  ug\SMGCA?><;97!5'4-240;.C,K*T(_&j#w! qcXPIC?<:964 20/$-++1)8(@&I#R!]iv}m`U L!E"@";!8!5 30 . , *!(!!&"(%"/#"6!">#G#P#["g"t!!    yi\!R#I$B%=%8$4$1$-$*%(%%&#&!''%',(3(;(D(N(Y(e 'r '&%$#""uf!Y$O&F'?':'5'1'-'()$*!++ ,,-"-)-1-9-B -K -V-a,n,}+*)(''q b%V'K)C*<*7*2*.**+$,.01222 2& 2.252>2H2R2^1k1z0/.-,+m$^(R*H,@,9-4,0,+-&. 0246 8 888#8*828:8D8O7[7h6w543211z#i(Z,N.E/=/7/2/-/(0"2468 ;< ==>>'>/>7>@>K=W=d@BCDDE#E*E3D=EGDSDaCpBA?>=<n-_1R3G5>58424+6$8:=?BDFHI JKMM&L/L8LCLOK]KlJ~HGEDCh2Y6M8C8<867.9&;>A DGILNOQR SUV!V)U3U>UJTXThRzQPNMKa8T;I<A;;:1<(?BE ILORTVXY[] ^`a#`-`8_E_S^b]u[ZXVU[>O?F??>5@+C!GK ORVX[^`bcegi kmm&l1l>kLj\ingecb`UCKDDC:D/H#LP UY]adgiknprtvx z|{){6zExVvhu|sqomQHIG?I3M&QW \afjmqtwy|~ ,;L_t}OMEN8R*W] ciotx|#2CVkKS=W/] dkrx~'9LayC]4c%jrz.AWnˈǥ;i+py "7Me}'1:BJQW\afkqw~ *4<DJPV[`ejpw $-5=DJOTY_djpx'/7=CINSX]biqz  (07<BGLQV\bjs}~|z")06<AEKPV\~c|l{vywutssqon #*}0z6y;w@uEtJrPpVo]mfkpi|hfeddecc{wus rqp%n+l0j5h:g?eEdJbQaX_`^j\vZYXXXXXX|tnjhfedcb&`+^1]6[;Z@XFWLUTT\ReQqO~NMLLLMM}qid`][Z XXW!V'T,R1Q6O<NBLHKOIXHaFlEzDBBBBBCtiaZWTRPONML#J(I-G3F8E>CDBL@T?^=i<v:998899{mbZTOLJIH FEDC%A*@/>5=;;A:I8R7[5f3s210/000ug \ T M I E C BA@ >=<!:'9,72684?3G1P/Z-d+q*(''&''p bWOHC@=; ; :9754$2*10/6->, F* O( Y& d# q! | k^SKD?;86543 1 0.!,(*.)5'=$E"O Yer    x h[PG@;741//,+)'%%#,!3;CMWcp    tdWMD=830-*)&$ " ")08AKU a m{p`TIA: 5 0,)&#  !!!"'"."6 "> "G"R"]"i!x ~l]Q F!>"7"2"-")"&!#"#%%& ' ' '$ '+'2':'D'N'Z'f&u%$#"! zhZ M#C$;%4%/%+$'$#$%&(* , ,,, ,',/,7,@,K,W,d+r*)('&%ud V#J&@'8'2'-')&%& '(*, .01122$2,242=2H2T1a1p0/-,+*p`$R'F)=*5*/)+)')!)+-/ 1356 788!8(808:8D8P7^7m65320/k$[(N+C,:-3,.+)+#,.02 469:< =>??$?-?6?@?M>Z>j={;:876e)V,I.?/7/1.,.%/1368;=?ABD FGG G)G2G<GHFVFfExCB@>=_.Q1E2<352/1'2 57:=?BEGIJLN PQQ#Q-Q7PDPROaNsLKIGFY3L5A69544+6"8<?BEHKMPRTVXZ \]\'\2[>ZLZ\XnWUSQPR9G:>:98.:$=@DHLORUXZ\^`beg jj i+h7hEfVegc|a_][M>D>=<3>(BFJOSW[^adfikmoqtw yy#x0v>tOtaqupmkiICCA8C,GLQW[`dhkoruwz| &4EXm~{yHF>H0L#RX^djosw{ *;NbyDM6R'X_fmsz 1DYo;W,^e mu}&9Of~ɘƴ3d"kt|/E\t#,5=ELRX]bgms{%/7?FLQW\afls|(18?EKPUZ`elt} !*28>DINSX^emv}#+28=BGLQW^eoy~yusq $+17<AF}K|QzWx^vgtrrpnmmlhff}{ zzy%v+t1r6p;n@mEkKiQhYfadkcxa`^]]\[[wrolkjjig%e+c0b5`:_@]E[LZSX\VeUrSRQPPQPP}rjeb_^] \[[ Y&W+V0T6S;QAPGNOMWK`ImHzFEEEEFFsh`ZVTRQP PPN!M'K,I1H6G<ECDJBS@\?h=u<;;:;;<yk`XQMKIHG FEEC#B(@-?3=8<?:F9O7X6d4q3211123qdYQJFCA@>> =<;9$8*7/554<2C1L/V-a,n+}))(()*|k^TKE @<:887 6542!1&/,.2,9+A)I'S&_$k"z! !wgZ O G @ ; 7 4 2 110 .-+*$()'0%7$?"G Q]iwrc VKB<72/-+ * * ) '%$!"' . 5 > G Q \ i w     n _RG?83/+(&%$# !&-5>GR \ hv    }j [OD<50+'$"  $+3 : CMXesy gXKA92-($!    '.6?JUbqtcTH>6/*&"    !$!+!3!<!G!R!` np_QE;3 -(#  "$% %&&!&(&0&9'D&P&]&l%~#" l[MB!8"0"*"%!"   !# $&() ++,,%,-,6,A,M,Z+j*{)'&$#gWI">$5%.$($$# "#$% ')+-/0 222"3*333=2I2W1g0y/-,*)bR#E&;'2',&'%"%%') +-/1357 9:::&:/:::F9T9c7u6431/\$M(A*7*0**(%()*, /1368:<>@ BCB"B+B6BBBOA_?r><:97V)H,=-4-.,(+!,.0368;=@BDGIK MMM&L1L=KKJ[ImHFDB@P/C0:120-.$0258;>ADGILNPRUW XX!W,W8VEVUTgS|QNLKJ4?57412(47:>BEHKORTWY\^`cf gf$e0d>cOba_v][YVE9<876,8!;@DIMQUX[^adfiknptwvu)s8rHqYnnmjgeB=<;1=$AFKQV[^cfjmpsvx{~.>Rf|{xvA@6B)FL RY_eimrv{~#4F[sCHMSZbku}|zxwpljh &,~2|7{<yAwGuMsSq[odmnk{ihffc_^]zwusssr p&m,l1j6h;gAeGcMaU`^^h\tZYWVVTSRunifdcc bba _&]+\0Z5Y;WAUHTORXPbNnM}KJIIHHItia\YWVUU UUS!Q&O+N0L6J<IBGJFSD]CiAw@>>>>>?xj_WQMKJIIIHGE!D'B,A1?7>><E;N9Y8d7r5433445obWOHDA@?>> >><:"9'7-634:3A1J0U.`-m,~+***+,yh[QHB=:76555 4310$.)-/,6*>)G'Q&\$j#z"!!!"#rcVKC<730/.-- ,+)( &&%,$3";!DNYgvm^QF> 7 2 .+('&%% $#! #)08AKWds|iZM B : 3 . ) & # !  &.6?I U b pweV I ?70*&"         % , 4 > H S ` n sa SF<4-'#  ")1;EP^l} o^ OC91*$   &/8BN\k| k ZL@6.'"  $,5@LYizgVH=3+%     ! ) 3!= I WgycRE90)#  "$ %%&&&'0':&F&T&d$v#" ^NA6-&! !#%(*, ---#-,-7-C,Q,a+s)(&$"YJ=!3"*"$!  !#%'*,.13 555 5)534?4M3]2p1/-+)S E#9%/%($#"!"# %'*,.1368:= ==>%>/=;=IADFIKNQSUUT%S1S>RNQ`OvLJHEB/8/0.*, .0 48;?BEHLORTWY\_bccb*`8_H^Z\oYWUR=35200%25 9>CGKNRUY\_adgjmpssr#q1p@oRlgj~gca:755*7;@EKPTY]aeiloruw{~ '8K^|uyvs;:/<!AFMSZ_dimrw{~ -@Ul4B&FMT\cjpuz"4I`y,MS[clt|)>TlͅƢ"Ybjqy3Iax  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~mft1!  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<D(K6QGW[[o^bflsߺzڷԶ͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵͵' 2<C'K5QGV[Zo\_ciovÁʽ׾ྸྸྸྸྸྸྸྸྸྸྸྸྸྸྸྸ' 2;C'J5PGU[XoZ\_dlt}˿ӳڳڳڳڳڳڳڳڳڳڳڳڳڳڳڳڳ' 2;C'J5PGT[VpXY]cjqyǵ„Ϊժժժժժժժժժժժժժժժժ' 1;C&J4OFSZTpUV\bhowíŀɢϢϢϢϢϢϢϢϢϢϢϢϢϢϢϢϢ' 1;B&I4NEQZRpRU[agmt}Ĝƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈɜƈ' 1:B%I3NEPYOoNTZ`flr{ɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅÖɅ' 1:A$H2MCOXLnMTZ`ekqx́́́́́́́́́́́́́́́́́& 19A#H0LALWKnMTZ`ejpw& 19@!G.K>JWKlM}TZ`diou|||||||||||||||||& 18@F*G=JVKjMzTZ`einsyyyyyyyyyyyyyyyyy& 07?C$G?IUKgNtU~[`eimr~w~w~w~w~w~w~w~w~w~w~w~w~w~w~w~w~w%/6<A'F?HRKaOmVv\|afim~qzvzvzvzvzvzvzvzvzvzvzvzvzvzvzvzvzv%, 1 5@)E>HNKZPdWl]qbufxjz|n|yq~vuvuvuvuvuvuvuvuvuvuvuvuvuvuvuvuvu$'!6?*C:GGKRQZX`^ech|gjyjlwnmtporsprsprsprsprsprsprsprsprsprsprsprsprsprsprsprsprsp&6<(@5E@KIQO~XTz^XwcZtg\rj]pm^np`mramramramramramramramramramramramramramramramramra) 38%>/D8K?yQEtWHp]KnbMlfNkiOilPhnQgqRgqRgqRgqRgqRgqRgqRgqRgqRgqRgqRgqRgqRgqRgqRgqRgqR% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ% /:B$I0Q?XQ_cdtjpw蜈噓┟ߑٌȀȀȀȀȀȀȀȀȀȀȀȀȀȀȀ$ /9A#I0P?WQ]cbugmt|棆➐ߚۖ̊пοοοοοοοοοοοοοο$ /9A#I/O?VQ\d`vejqy⩂ݣ՜˒ոѸѸѸѸѸѸѸѸѸѸѸѸѸѸ$ /9A#H/O?UQ[d^wbgnu۫}Ѣʜ×Ӽױӱӱӱӱӱӱӱӱӱӱӱӱӱӱ$ /9@"H/N?UQYd]x`djܵqҮx˨âͻԵثԫԫԫԫԫԫԫԫԫԫԫԫԫԫ$ /8@"H.N>TQXe[x^afպnʹvŮ~ƼʹԮإեեեեեեեեեեեեեե$ /8@"G.N>SQWeYy[^dkǺs{ŷ̮ӨנԠԠԠԠԠԠԠԠԠԠԠԠԠԠ$ /8@!G-M=RPUeWyX[biqyı˨Ѣ՛ӛӛӛӛӛӛӛӛӛӛӛӛӛӛ$ /8?!G-M=QPSdTyTY`gowëÁɡϘҕѕѕѕѕѕѕѕѕѕѕѕѕѕѕ$ /7? F,LE*K9NLMbLwQW^ekry΂̎˚˚˚˚˚˚˚˚˚˚˚˚˚˚˚# .6=E(J7LIKaLuPW^djpwщГГГГГГГГГГГГГГГ#.5=D%I3IIJ`LsQX^djou|ք|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ|Ռ#-4<B D0HJJ^LoQ|X_dinsy|x܆x܆x܆x܆x܆x܆x܆x܆x܆x܆x܆x܆x܆x܆x܆#, 3:>D2HIJ[LiRuY}_einr|wx|u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖u䁖"* 0 4 <C4GGIVMbSlZs`xf|j~n{rxvuzs~s~s~s~s~s~s~s~s~s~s~s~s~s~s~!'(- <B3EBIONYTa[gakfn{jqynsvqtstvqxwo{xo{xo{xo{xo{xo{xo{xo{xo{xo{xo{xo{xo{xo{xo{x0:!?0D=IGNOTV\Zzb^wf`tjbrmcppensfmvgkxhkxhkxhkxhkxhkxhkxhkxhkxhkxhkxhkxhkxhkxhkxh07 =,B6H>NEyTJu[NqaPofRmiSklUjoViqVgtWfvXfvXfvXfvXfvXfvXfvXfvXfvXfvXfvXfvXfvXfvXfvX!-39'@/{G6tN;nT?}ICC_PROFILE jYAh_CfcEegFcjGblHboHaqI`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ`sJ" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -8? G+O8XH`Xggnvu}򑅖񏐝슦ꇲ~Ͳuеr϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶r϶" -7? G*O8WH_Xehlxrz푌돘錤爲~̹s̼r̻r̻r̻r̻r̻r̻r̻r̻r̻r̻r̻r̻r̻" -7?F*N8VH]Ycjizov蕉呔ጟ݈ك{vvʾvʾvʾvʾvʾvʾvʾvʾvʾvʾvʾvʾvʾ" ,7>F*M8UH\Yakg{ls{★ݑ֋τ}Ǻzøzzzzzzzzzzzzz" ,6>F)M7THZY`kd}jpxڙѐˊƆȽɳ~Ų~ò~ò~ò~ò~ò~ò~ò~ò~ò~ò~ò~ò~" ,6=E)L7SGYZ^lb~gmܤtҚ{˓Ŏźɶ˭ǬĬĬĬĬĬĬĬĬĬĬĬĬ! ,6=E)L7RGXZ\m`e߰jէp͞xƘƳʯ̧ȦƦƦƦƦƦƦƦƦƦƦƦƦ! ,6=E(L6QGWZ[m^b۳gѫnɣv~ƭʩ̡ɠƠƠƠƠƠƠƠƠƠƠƠƠ! ,5=D(K6QGVZYm\_׸eͯmŧt|ƨʣ͛ʛǛǛǛǛǛǛǛǛǛǛǛǛ! ,5<D'K5PFUYXmZ]ҼdɳkrzŢʝ̖ʕǕǕǕǕǕǕǕǕǕǕǕǕ! ,5<D'J5OFSYVmW\bŸipxŜɗˑʐǐǐǐǐǐǐǐǐǐǐǐǐ!,4<C&J4OERXSmUZ`gnv~ÖǑʌɋNjNjNjNjNjNjNjNjNjNjNjNj!,4;C%I3NDPWQlSX^els{ŋLJdžņņņņņņņņņņņņ!,4;B$I2MBOUNkQV[biqyÃő…ȩĂā!+3:B"H/L@LSLjP}U[biqyЂ΍͝{̵{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ{ͽ +2:A G,J;JSKhOzT[bipw~ԇ|ӔwҦvҭvҭvҭvҭvҭvҭvҭvҭvҭvҭvҭvҭvҭ +18?E&F)B7GCKMQUX[_`{ecwiftmhrpipsknwllzmjnioioioioioioioioioioioioio ) 5;&@2F,D4zJ:tQ?oVCk]FibHggIfjJemKdpLcrMauN`xN`yO`yO`yO`yO`yO`yO`yO`yO`yO`yO`yO`yO`yO& -4;&vB,oI1iO5eU8bZ:`_;^c<]g=\i>[l?Zn?Zq@YtAYuAYuAYuAYuAYuAYuAYuAYuAYuAYuAYuAYuAYuA *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *6=E&N2W?`Nh\pixt~󇒌򅜒~{ȟwҢo֤k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦k٦ *5=E&M2V?^Nf]njuw}򋅊샤뀯}{Ǧvҩn֫jլjլjլjլjլjլjլjլjլjլjլjլ*5<D%L1T?]Od^kmqzy펁닊臔惟|yůtѲmѳmӯmӯmӯmӯmӯmӯmӯmӯmӯmӯmӯmӯ*4<C%K1S?[Ob_hon}u}历ሏރ~yuq̻p϶qѲqѲqѲqѲqѲqѲqѲqѲqѲqѲqѲqѲ*4;C$J1R?YO``fplrzߐوр{xwv˽t͹tдtдtдtдtдtдtдtдtдtдtдtд*4;B$J0Q?XO^`dqioߚvؑ}Јʃ|zzǿw̻w϶w϶w϶w϶w϶w϶w϶w϶w϶w϶w϶w϶*3:B$I0P?WO]abrglڜrѓyʌņ~}{˽{θ{θ{θ{θ{θ{θ{θ{θ{θ{θ{θ{θ*3:B#I/O>VO[a`sdިiԟp͖wƏ~ʾ~͹~͹~͹~͹~͹~͹~͹~͹~͹~͹~͹~͹)3:A#I/O>UOZa^sbګgѢnɚu“}¢ʿͺͺͺͺͺͺͺͺͺͺͺͺ)2:A"H.N>TOYa\t߷`֯fͦlŞs{Ü̻̻̻̻̻̻̻̻̻̻̻̻)29A"H.N=SNWaZtݻ^ҳdʪkqyÖ̼̼̼̼̼̼̼̼̼̼̼̼)29@!G-ME(J6LGL\PpUZ`fmu}|z̻yθyθyθyθyθyθyθyθyθyθyθyθ( /6=D%H2HDK[OnSX^djr{ʅz˓wΨuɶtдtдtдtдtдtдtдtдtдtдtдtд( .5<B D-HDJZMlR{X^elt|}ڄyُtמqִoƭoƭoƭoƭoƭoƭoƭoƭoƭoƭoƭoƭ' - 39>C.HEJXLhRuX_flr~yzလvqޒnޢlݯlݯlݯlݯlݯlݯlݯlݯlݯlݯlݯlݯ& + 0 4 ;C0GDJULcRnYw`~fl~rzwv|s烐o拒l喔j堕j堕j堕j堕j堕j堕j堕j堕j堕j堕j堕j堕#')+;B1FBIPM\SeZlargv}lyyq|vu~szpmjhhhhhhhhhhhh / ;A0E>IINSS[[`ae{ghwlktpmqtoowpm|qkshtgugugugugugugugugugugugu09>-C8IANISO{ZTvaWsgZpk\no^lr_ju`hyag}beddddddddddddddddddddddddd  /6<(B1H9zN?tSDpYGm`JjeLhjMgmOepPdsQcvQbyR`~S_T_T_T_T_T_T_T_T_T_T_T_Tշ!+29#}?*uF0oL5jR8eW;b]=ab?_f@^jA]mB\pB\rC[uDZyEY{EY{EY{EY{EY{EY{EY{EY{EY{EY{EY{EY{E'.z5r=#jC(eJ,`P.]V0[Z2Y_3Wb4Ve5Uh5Uj6Tl6So7Rr8Qu8Qu8Qu8Qu8Qu8Qu8Qu8Qu8Qu8Qu8Qu8Qu8~|(x4<D"L,U8`EiQr\zgow|}zxvtÎs͐pےjޔeeeeeeeeeee~|(x4<D"L,U8`EiQr\zgow|}zxvtÎs͐pےjޔeeeeeeeeeee~|(x4<D"L,U8`EiQr\zgow|}zxvtÎs͐pےjޔeeeeeeeeeee~|(x4<D"L,U8`EiQr\zgow|}zxvtÎs͐pےjޔeeeeeeeeeee~|(x4<D"L,U8`EiQr\zgow|}zxvtÎs͐pےjޔeeeeeeeeeee~|(x4<D"L,U8`EiQr\zgow|}zxvtÎs͐pےjޔeeeeeeeeeee~|(x4;C"L,U8_EhQq]yhpx~}{xvtÐs͒pڔiޖeeeeeeeeeee}(z3;B"J,S8]EeSn`uk}u~|yvtr͜mٞgݠeޞeޞeޞeޞeޞeޞeޞeޞeޞeޞeޞ}(|2:B!I+Q8[FcTkbrnyy툁넉耓|xuro̥kاg٦hܢhܢhܢhܢhܢhܢhܢhܢhܢhܢhܢ~(~29A I+P8YFaUhcoqv}}憅⁎|wsolƮjԯkשkڥkڥkڥkڥkڥkڥkڥkڥkڥkڥkڥ' 19@ H+O8WF_Ufdlsszہztqon±nұmլn٧n٧n٧n٧n٧n٧n٧n٧n٧n٧n٧' 18@G*N7VF]Vdfjupwډ}Ҁ{wtrqqгpԮqשqשqשqשqשqשqשqשqשqשqש' 18?G*N7UF\Vbfgvmۓsӊz̈́~zwutt̵sӰt֫t֫t֫t֫t֫t֫t֫t֫t֫t֫t֫' 07?F)M6TFZV`gexޠjՖpΎwȇ‚~{xwwɶwҲwլwլwլwլwլwլwլwլwլwլwլ' 07>F(L6REYV^gcyڣhњnʒuċ|~|{{Ʒzѳzԭzԭzԭzԭzԭzԭzԭzԭzԭzԭzԭ' 07>E(L5QEWV\h߯ay֧fΞmƕsz~ø~е~ԯ~ԯ~ԯ~ԯ~ԯ~ԯ~ԯ~ԯ~ԯ~ԯ~ԯ' /6=E'K5PDVVZhܳ_yҫeʢk™qx϶ӯӯӯӯӯӯӯӯӯӯӯ' /6=D&J4PCTUXgظ]yϮcǦiov}϶ӰӰӰӰӰӰӰӰӰӰӰ' /5=D&J3OBRTWgԻ\x˲bêhnt{Ϸұұұұұұұұұұұ' .5<C$I1NAPSUfпZwǷ`flryϷұұұұұұұұұұұ& .4;B#H0L?OPSeYvü^diov~϶ұұұұұұұұұұұ& -4;A!G-KC#E5JKN_RqW\bhov{vŋrƙpǯnϬmשmשmשmשmשmשmשmשmשmשmש% * 0 6;>E6IKL]QmVz[ago}wwրs؋pٙmۮjɤhۤhۤhۤhۤhۤhۤhۤhۤhۤhۤhۤ# (- 1 2 ?!E7HJKZPgVs\{bipzxv怒r刔n䒖k㟗h㳘fƙfƙfƙfƙfƙfƙfƙfƙfƙfƙfƙ!%'&3?$D7HGKUP`Vj]qcwj{{pwvs|ol튇j앉f룊d겋d겋d겋d겋d겋d겋d겋d겋d겋d겋d겋5>%C5GCKNPXW_]e~djzjmvpprtsoyumvjxhye{c|c|c|c|c|c|c|c|c|c|c|&5<%A2F=KGPNWT{^Ywd\sj_poamsckwei{fggeicjakakakakakakakakakakakڶ ( 3:#?-E6K>zPCuVHq]LncNkiPimRgqTfuUdxVc|WaX_Y^Z^Z^Z^Z^Z^Z^Z^Z^Z^Z^ZܬϿ' 07='}C/uJ4oP9jU `D#[J&XP(UU)SY+Q]+P`,Oc-Nf.Mh.Lk/Kn/Jr0Iu0Iu0Iu0Iu0Iu0Iu0Iu0Iu0Iu0Iu0Iu0wt( p4y:BK'T2_cJlWtb{lt||yuroljȕh֗dbccccccccccyw' w07?F&N1W>aKiXqdxo냀y~zuqmjhƝeӟdޟeffffffffffyw' y/6>F%M1V>_LgYnfur|}〄zupkhgfΣfܢgߜh☿h☿h☿h☿h☿h☿h☿h☿h☿hzx& {/6=E%L0T>]LdZkhruy݁ztpmkjiʦiڥjݟkkkkkkkkkkzx& |.5<D$K0S=[Lb[ijox݋uՂ{|wspnmlƨlبmܡnߜnߜnߜnߜnߜnߜnߜnߜnߜnߜ{y& ~.5<C#J/Q=YL`\fkޖlz׎rІyˀ{vsqpoªoժpۤqޞqޞqޞqޞqޞqޞqޞqޞqޞqޞ{y& -4;C#J.PE'J5NDTY̻Zjó_xejpv}֫ڥڥڥڥڥڥڥڥڥڥ~}$ * 07=C%H1LCRWȿXi^wchnt{}{{֪|ڥ|ڥ|ڥ|ڥ|ڥ|ڥ|ڥ|ڥ|ڥ|ڥ~$ ) /6<B!F,IAQVVg[vafkqxzwutةuڤuڤuڤuڤuڤuڤuڤuڤuڤuڤ# ( . 4:?@)H?OTTeYs^ciov~~ytqon٦oܢoܢoܢoܢoܢoܢoܢoܢoܢoܢ" ' , 2 7;?&G=MQRbWp[|afl~sx{solj¹hۢhޞhޞhޞhޞhޞhޞhޞhޞhޞhޞ!%*.0 6A'FxuFvNsTqYo]m`kcifhhfjeldmcobp`q^r^r^r^r^r^r^r^r^rnk) g5p9vAzJ#}S,|_5zj>xuFvNsTqYo]m`kcifhhfjeldmcobp`q^r^r^r^r^r^r^r^r^rnk) g5p9vAzJ#}S,|_5zj>xuFvNsTqYo]m`kcifhhfjeldmcobp`q^r^r^r^r^r^r^r^r^rnk) g5p9vAzJ#}S,|_5zj>xuFvNsTqYo]m`kcifhhfjeldmcobp`q^r^r^r^r^r^r^r^r^rol) i4r8x@|I#R,]5}h?zsHx|PuVs\pandlhjjhmgoeqdrctbu_w\w\w\w\w\w\w\w\w\wpm( k2u7|?G#P,[6f@~oJ{ySxZuasfpkmokriugwfyd{c}a~\]}]}]}]}]}]}]}]}]}pm( n1x6~>F"O,X6cAmL~vV{~^xeulqqnulyi|gełcфb߆_^_________qn( p/z5=E"M+V6aBjMsX~{azjvqrwo|lifdÊbЌ`_`aaaaaaaaaqo' r.|4<D!L+T6_ChOpZxe}nxvs}okgda_͔_ݔaccccccccccro' t-4;C K*R6\CePm\uh|rz|tnifdcbȗbٗde玿fꊿfꊿfꊿfꊿfꊿfꊿfꊿfꊿfsp' v,3:B I*Q6ZCbQj^qk߂xw{~tpligfeĚeӚg◻h摹i荹i荹i荹i荹i荹i荹i荹i荹isp& x,29AH)O5XC`Qg`ߍnnمt{~{xtpmkihhϝjk䔲l搲l搲l搲l搲l搲l搲l搲l搲ltq& z+28@G(N4VC]ReaڐkpӉq{͂x|wtpnllk˟mߜn㖫o咫o咫o咫o咫o咫o咫o咫o咫otr& |*18?F'M3SB[QݝbbՕio΍o{ɆvÀ|{wtrpooȠpݞq☥r䔥r䔥r䔥r䔥r䔥r䔥r䔥r䔥rtr& }* 07>E&L2QAZQڢ`aљgoʑmzĊtz{xutsrštڠuᙞu㕞u㕞u㕞u㕞u㕞u㕞u㕞u㕞uus% ) 06=D%J1P@ޭXPզ_aΝenǕkzqx~|ywvv¢w֢xx㖘x㖘x㖘x㖘x㖘x㖘x㖘x㖘xus% ) /6<C#I0O>۱WOҩ]`ʡdnÙjypu|}|zz{ӣ|ߜ|◒|◒|◒|◒|◒|◒|◒|◒|vt% ( .5<B"H.M<ضUNϭ\_ǥbmhynsyѣߝᘌᘌᘌᘌᘌᘌᘌᘌvu$ ( . 4;A G+ݾL:ԹTM˱[^éalfxlqw~ϣޝᙆᙆᙆᙆᙆᙆᙆᙆww# ' - 39?E(J8нRLȶY]_kdwjou{}ͣޝwy! & , 28>C#H7QJûW[]jbvhmry~{xwʢxߝyyyyyyyyyx{ % + 0 6;=F5OIUZ[h`te~jpv}}xtrpȠqߜrrrrrrrrry~ $)- 2 68D3MFSWYe^qc{hmt|{vrnljǜklllllllllz"&),,7B0KCQTVb[n`wek{quyplifeƗdeeeeeeeee| "!*:B,I?OPT^Xi^rcz{itoowjʀfʋc˚a̭`Ő__________} - ;B-F=MLRXWb]j|cpviupozlw}h݀dދaߙ_ૅ]\[[[[[[[[[ؽ0;A-F:KFQPWX|^^wdcrjhnpkjwngpdsat_v\w[wZwZwZwZwZwZwZwZwZw س 19@*E6K?PGzWMu^RqdVmjYjp\gv^d|`bb_d]e[fYgXhXhXhXhXhXhXhXhXhکκ$08>'D0|J7vP=qVBm]EicIfiKdnMbtO`yQ^R\TZUXVVWUWUWUWUWUWUWUWUWUWݟϲ$ -5<"xC)rI.lO3gT6cZ9``<^f>\k?[pAYuBXzCVDUESFQGPHPHPHPHPHPHPHPHPHѪƼ! *}2t9m@"gG&bM)^R,[X.X]0Vb1Tf3Sk4Qo5Pt6Ny6M~7L8J9I9I9I9I9I9I9I9I9I9ǵy&p.i6b=]CXI!UO#RT$OX&M\'K`(Jd(Hh)Gl*Ep+Dt+By,A-@-@-@-@-@-@-@-@-@- vl! d)]1W8R>NDKIGNERCUAY?\>` nDlJjNhRfUdWcYa[`]__^`]a\b[cZdYdYdYdYdYdYdYdYdgc* c2l6r>vGxP'yZ/wf8tq@r{GoMlRjWhZf]d`cbad`f^h]i\j\kZlZjZjZjZjZjZjZjZjhd* f0o5u=yE{N&}X0{d9xnBuxJrQoVl[j`gcefciak`m^o]q\r[s[p\n\n\n\n\n\n\n\nhe) h/r4x<|DL&V0a:|kCxuLu~Tr[n`kehifmcpas_u^w\y[z\x]t]r]r]r]r]r]r]r]rie) j-t3{:BK&S0^:iE|rNxzWt_pfmkipftcx`{^~\̀Zۂ[^|_w_v_v_v_v_v_v_v_vjf( m,w2~9AI%R0\;fFoQ|w[wdrknrixe}b^]\ȇ\ֈ]`a{bybybybybybybybyjg( o*z18@H$P/Y;cGlSs^zzhtqnyifca`_Ë^ы`cdd}d}d}d}d}d}d}d}kg( r) |07>F#N.V;`HhTpa|vmv}vq|mjgecbb͎bߍf눹gggggggggkh' t) /6=E"L-T:]HeVۇlcԀsnzzvu}qmjhfeeɑeۑi鋲j텱jjjjjjjjli' v( .5<C!J,Q9[GݓcVՌjdτqn~wwy~}uqnljihœh֓l莫m쇪m텪m텪m텪m텪m텪m텪m텪mlj& x' -4;B I+P8YG٘aVѐhcˈonłuw}{~yurpnlllҕo搤pꉣq쇣q쇣q쇣q쇣q쇣q쇣q쇣qml% z' - 3:AG)N6ݣWFԜ_U͔fcnjmnswy~}yvsqpppϖs咝t鋜t눜t눜t눜t눜t눜t눜t눜tmm$ {& , 29?F'L5٨UEѠ]UʘdbÐkmqvw~|}zwutss͗v㓖w錖wꊖwꊖwꊖwꊖwꊖwꊖwꊖwno# }% + 18>D%ޱK2լTDͤ\TƜcaimovt}z~{yxxxʘzᔐ{荐{鋐{鋐{鋐{鋐{鋐{鋐{鋐{nq! % * 0 6=C#ܵJ0үSCʨ[S aaglmur}x~~}||Ș~玉~錉~錉~錉~錉~錉~錉~錉~or $ ) / 5;AعG/ϳQAǬYR``ekkup|v|Řޖ珃范范范范范范范ot #( . 39޽>ԽF-˷P@ñWP^^djitn|tz|zØ{ۖ}}}}}}}}}pv"', 1 58D+ǼN>VO\]bhgrlzqw~}yvttٖvvvvvvvvvqy!%)-0 5B)L$H6OGUT[``ieqjxyp}svn~jfcb`Ԍbbbbbbbbbu߼ . ; E2MBSPX[]dblxhrrnwmu{h}dƇaƔ^ƥ]ǻ[ԅ\\\\\\\\\yڲ2<C/J=PJVT[]x`drfjllogsrc|v_ֆx\ؓzZ٥{Xں|W{XyXxXxXxXxXxXxXxXx ۨѸ#3< B-H9OC~UKx[RsaWng\jm`ftcb|f_h\jZkXlVmUmUmUmUmUmUmUmUmUmүɿ '3;A*H3|M;vTAq[FlaKigNemQbsT`zV]X[YX[W\U]S^S^S^S^S^S^S^S^S^ԧɸ' 19@%xG,rM2lR7hY;e_>beA_kC]qE[wGY}HWJUKSLRMPNONONONONONONONON؞ʱ& /|7t>nE%hK)cQ-_W0\\2Zb4Xg6Vm7Tr9Rx:Q~;OJ?J?J?J?J?J?J?J?J?̪# x,p4i;cB^H!ZN$WS&TY'Q])Ob*Mg+Lk,Jq-Hv.G|/E0D1B1A2A2A2A2A2A2A2A2ô~t l( d0^7X>TDPIMNJSHWE[ D`!Bd"@h#>m#=r$;w%:|%8&7&7&7&7&7&7&7&7&{qg_" X* R1M8I>ECBG?L=P:S8W7[5_3c1g/k.p,v,x,x,x,x,x,x,x,x\"W- V6^9c@fIgS!g^(el.cx3a8_;^?\A[CZEYFXHWIVJVKULTLTMSNSNSNSNSNSNSNSNSN\"W- V6^9c@fIgS!g^(el.cx3a8_;^?\A[CZEYFXHWIVJVKULTLTMSNSNSNSNSNSNSNSNSN]"X- X5_7e?hHiR!i](hj.fv4c9a=_A^C\F[HZIYKXLWMWNVOUPUQTQTRTRTRTRTRTRTRTR]"Y, Z3c5h=lFmP"mZ)lg0js6g}hCeHcLaO_Q^T\V[XZYY[X\W]V^V_X[X[X[X[X[X[X[X[_!Z+ `/i3o;rCtL!uV)tb2qm9nw@kGhLfPcTaW_Z^\\^Z`YbXcWeVfXcZ_Z_Z_Z_Z_Z_Z_Z_` [+ b- l1r9vBxJ!yT*x_2uj;rtCn}JkPhUeZc]`a^d\fZhYkWlVnWkZh\c\c\c\c\c\c\c\c` \+ e+ o0v8z@|H!}Q)}\3zgF O)X3c>{mHvvQq}Ymahgdm`r]u[wZyYzYzYz\u_qalalalalalalalalb_) k' u.|5=DM(U3`>jJzrTty^ngjmfrcuax_z]|\}\~[~_zbucocococococococoba' n& x- 4;CJ'S2]?fK~nWwubr|inojtgxe{b}a`_ǂ_ׂb~exfsfsfsfsfsfsfsfscc& p% {, 29AH&P1Z>݉cLւkX|rbwyjrpnukyh}fdcbÄb҅e偳h|iviuiuiuiuiuiuiude$ r% }+ 18?F$N0ߔX=َaLцiX̀pb{vjv|qrvozl~jhgffχhÅl~mxmxmxmxmxmxmxmxdg# t$ * 0 7=D"L.ܙV<Ӓ_K͋gWDŽnbtjzzqvvs{pnlkjjˉk߆opzpzpzpzpzpzpzpzei! v# ) / 5<C J,؝T;Ж]JɏeWÈkarj~wqz}ww|trpnnmȊo݉rs|s|s|s|s|s|s|s|ej x#( . 4:AݧI)ԡR:̚[IœcVjapiuq~{w{|xvtrqqŋrڊv턔v}v}v}v}v}v}v}v}flz"', 2 8>ګG'ХQ9ɞZH—aUh`nispyv{|zxvuuÌv֌y녎z~z~z~z~z~z~z~z~fn|!&+ 0 6߮<֯D&ͩP8ƢXG`Tf_lhqpwv|{~|{zzzԌ}ꆇ}}}}}}}}gp~ %). 3 ݴ8ҳC%ʭN6¦WF^Sd^jhoouvz{~}Ҍ釁gr#'+/ ٺ4ϷA#ƱL5UE\Rb]hfmnruxz~}zxwЌy{{{{{{{{ht!$'߷)Ծ1˻@!¶K3SCZP`\fekmpsvy|~{wtqp΋sttttttttiw  . =I1QAXN^Ydciknqsw~y|yuqmkj̉lnnnnnnnnj{ߺ, ;F.O>VK\Va`fhkn~qtxwys~}njgecʆeg~g~g~g~g~g~g~g~n۱ӿ( 8D*M:TGYS_\dc}ijwoorutm|xh{d~a_^ɀ^`z`z`z`z`z`z`z`zsۧҶ $5A&J5QBWM\V|b^vgdpmiksngzqcu_w\yZ³yYyXxZtZtZtZtZtZtZtZtx  ӭ˼"3>!G/NuYFo_KjePfkTbrX_y[[]X_VaTbRbQbQbQaQaQaQaQaQaQaٛͬĻ) 4<C'xJ/rQ6mX;h^?edCbjF_qI\xKYMWOTQRRQSOSNSNSNSNSNSNSNSNSޓϥŵ) 3|;tB"nI(hO,cU0`\4]b6[h9Xn;Vt=T{>R@PANBMCKDJEJEJEJEJEJEJEJEҞƯ ' w1p9j@dF _L$[R&XX)U^+Sd-Qi.Oo0Mu1K|2I3G4F5E6C7C7C7C7C7C7C7C7ȩ |s$ k-e5_<ZCUIROOTLY!J^"Hc#Fh$Dm%Bs&@y'>(=);*:*:*:*:*:*:*:*:*xog _) Y0T7O>KCHIEMBR@V=[;_9d7i5o3u2{0. . . . . . . . tkbZS# M* H1 C7@=K>K>K>K>K>K>R%M0 O5 V8Z?]H]R\]"[k'Yw+W/V2U4S6R8R9Q:P;PN?M?M@M@L@L@L@L@L@L@L@L@S%N/ Q3 Y6^=`GaQ`["_h(]t-[1Y5X7V:UR@RAQBPCPCODOENENENENENENENENENET$O/ T1 [4a<dEdOdY#cf)ar.^|3\7[:Y=X?VAUCTDTESGRHQIPIPJPKPJPIPIPIPIPIPIPIT$O. W/ _2d:gChMhW#gc*eo0by5`:^>\AZCYFWHVIUKTLSNROQPQPQQRNSMSMSMSMSMSMSMU#P. Z- b0h9kAlKlT$k`+ik2fv8d=aB_E]I[KYNXPWRUSTUSVRXQXSVTSUQUQUQUQUQUQUQV#R, ]+ f/ l7p?qHqR$q\,nh3kr:h|AeFbK_O]R[UYXWZV\T^S`RaS_U[WXXUXUXUXUXUXUXUW"U* `) j. p5t=vFvO#vY,sd5oo=lxDhKePaU^Y\]Y`WcUfTgShShVdX`Z]\Z\Z\Z\Z\Z\Z\ZX"X( c& m, t3x;zC{L#{U,xa6tk?ptHk|PgWc]_b]e[gYiXkWlVmVmXi[e]a_^_^_^_^_^_^_^Y![& g$ q+ x2|9AI"R,~]6ygAtpKowTj[faceah_k]m[oZpYqYq[n^jaebbbbbbbbbbbbbbZ!]$ j# t) {0 7?G O*Z6~dBxlMstVo{]kbhgejbmap_r^t]u]u^s}ICC_PROFILEandiffffffffffffffZ `"l" w( ~/ 5=DL)߈W5كaB}iMxqVsx]o~clhilgodrcuavax`xaweqglihihihihihihih[ b!o!y' - 4:BJ'ێU3ӈ^A͂gM|nVwu^s{dpimmkqhtgweydzd{dzhtkolklklklklklklk\ dq |&, 2 8?ߗG$֓R2ό\@ɆeLÀlV|r^xxdt~iqnorlujxizh|h}h}kwnqomomomomomomom\fs~%*0 6=ܜF!җQ1ːZ?ŊcKjUp]|vdx|junsrpvnym|l}k~l~oyrsrororororororo]hu#(. 4 :ؠC ϚO0ȔY?aKhUn]td|yjynwstwrzq|p~oor{uuvpvpvpvpvpvpvp]iw"'+1 ޥ6ԤB̞M/ĘW=_JfTl]rcwi}}n{sxwvzu}tst΀v|yvyryryryryryryr^ky!%)-۫2 Ѩ@ȢL.U<]IdSj\pcui{ns}w{zy}xxx́z}|w}s}s}s}s}s}s}s^m{"%(ׯ/ ͫ>ŦJ,T;[HbRh[nbshynswz~}~}|}z}ʁ|~~xsssssss`p~ ݮ!ӳ- ʰ<H+R9ZF`QfZlaqhvm|rvz{}xvtȀu~xxytytytytytytytbsٵϷ+ ƴ:G)P8XD^OdXj`oftlzq~uyyu|r~onn}qxstststststststevٯӹʻ(8D&N5VB\MbVg^mdrj}xox~sswozk|i}g}g|jwlslslslslslslsiy ٦ҳͽ %6B#L2S?ZJ`SeZja{pfvukq|pmsiveyczazaydteqeqeqeqeqeqeqm~ ۝Ҫ̷!2? I.Q;XF]OcV{h\umbpsgkzkgncq`s]u[u[t]p^n^n^n^n^n^n^nr  Ԣ̰ż. <F)N6U@[IzaPtfVol\jr`eydag^jZlXmWmVmWjXhXhXhXhXhXhXhxؚΨƶ* 8C#K/R9yYBs^ImdNijSdpX`w[\̀^Y̋aV̙cT̫dRdRcRbS`S`S`S`S`S`S`ݑСǰ)6?~H(wP1qW9l]?gcDciH_oL[vOXRUފTRޗVPߩWOWNWNVNVNVNVNVNVNVNVәȩ+ 6{>tF#mM*iT/e[4aa8^h;[n>Xu@U}CSEPFNHLHKIJIJIJIJIJIJIJIJIْʣ + w5p=jDdK"`Q&\X)Y^,Vd/Tk1Rq3Ox5M6K8I9H:F;E;D;D;D;D;D;D;D;͝­ zr) k2e:`A[HWNTT QZ"N_$Le%Jk'Hq(Fy*D+B,@-?->.=.=.=.=.=.=.=.ĩ~v nf&`/ Z6U=QCMIJOGTEYB^@c>i0 :6 6; 3? 0C -G*K(P%U#Z _ekqx}}}}}}}H(A3 F6 K8 O>QHPSO_Nl Lx#K&J(I)H+G,G-F-F.F.E/E/D0D0D0D0D0D0D0D0D0D0D0D0H(B3 H4 N6 R=UGTQR\Qi!Pu$N'M*L,K-J.J/I0H1H2G2G3G3F4F4F4F4F4F4F4F4F4F4F4I'C2 K2 Q4 V;XEXPVZUg"Ss&R~)P,O.N0M1L2K3K4J5J6I6I7H8H8H8H8H8H7H7H7H7H7H7J'D2 M0 T2 Y:\D\NZXYd#Wp'U{+T.R1Q3P5O6N7M8M9L:K;KO?N@NAMBLCLCKDLBM@M?M?M?M?M?M?L&J- T+ \. b6e?eIdRc]$aj*_t0\~4Z8X;V>U@TBRDQFPGOINJMKMLNIOGPDQDQDQDQDQDQDM%N* X) `- f4i=jFjOiZ%ff,dp2az8^=\AYDWGVJTLSNQPPROSNUORQORLTITHTHTHTHTHTHN%Q([& d+ k2 n:pCoLnV%lb-il4ev;b~A_F\KYOWRUUSWRYQZQZP[RXTTVQXNXMXMXMXMXMXMN$T&_# h) o0 s8u@uItR%q^.nh6jq?fzFbL^R\UZXXZW\V]U_T`T`U^WZYV[R\R\R\R\R\R\RO$W#b!l' s. w6z>zFzO$wZ.se8nmAjuIf}OcT`X^[\^[`YbXcXdWeXd[_][_W`V`V`V`V`V`VP#Z!f o&w, |3 ;CK#}W-xa8sjBorJkyQhVeZc]a`_c]e\g[h[h[i^c`_cZcYcYcYcYcYcYQ#]is$z* 1 8@H ۃT,}^8xgBtoKpvQl|Wi[g_ebceah`i_k^l^lagdbf]g\g\g\g\g\g\R"_kv#}(/ 5<ތEֈQ*ς\7}dBxlKtsRqyXn\k`idggejdlcmbnboejgej`j_j_j_j_j_j_S"anx!&,2 9ڑCьO)ˆY6ŁbA|iJxpRuvXr|]oamekhikhmgofpfqhmkgmbnanananananaU cp{ %)/ ߖ5֕AΐM(NJW5`AgJ|nRytXvz]saqeoimllojqjrjrloniqdqcqcqcqcqcqcWer}"&+ܛ1 ҙ?ʔK'ÎU4^@eIlQ}rWzx]w}aufsiqmopnrnsnsoqrkteududududududYgt #'ٟ-Ϝ=ǘI&T3\?cIjQpW~u]{{ayfwjumtprrrtrtsrulxgxexexexexexeZivߞ ԣ+ˠ;ÜH$R2Z>bHhPnWs\ya}f{jymxpwsvt~vu~wsyn{h|f|f|f|f|f|f\kyۤЦ)Ȥ9F#P1X=`GfOlVq\wa}ej~m}p||sz{tx{ux|tz~n}i}g}g}g}g}g}g^n{ ֨ ͪ'Ĩ7D!N/W;^EdNjUo[u`{ei~mzpvrttruqttowiwhwhwhwhwhwhaq~ ֢Ѭ Ȯ$5BL-U9\CbLhSmYs_xd|hxltopqnslsksmnpiqhqhqhqhqhqhdt  ؛Ѧ˰ó!3@J*S7ZA`JfQkWp]{vav|frjnmjogqfqeqgmihjgjgjgjgjgjgh x ۓҟ˪ŵ0 =H'P3W>^FcNiTynYtt^pzblfhidlam_n_n`jcfcecececececel|՘ͤƯ, :E#N/U9[B~aIxgOslUnrYjx^fabd^g\hZiYhZf\b\a\a\a\a\a\aqڐϞǪ'6BK*R4}YG#|O-vV5p]H>G>F>F>F>F>F>F>F>ґơ x q, k6e?`F\MXSUZ"R`%Pg'Mn)Ku+I}-G.E/C0B1A1@1?1?1?1?1?1?1ɜzsl f+`4 [;WBRIOOLUJ[GaEgBn @u!>~"<#:$9%8&7&7&7&7&7&7&7&ynga['U/ P7 L=HDEIBN?T=Y:_8e5l3s1|/-,+++++++xkb[ TN"I)D1@7 =< 9A 6F 3K1P.U+[)a&h#o!wyj]UNHB="8)4/04,8)< &A #E J O U [ a h o v~=+75 ?5 C7 F=GGGRF^DjCvA@ ?!?">#>#>$=$=%=%<%<%<%<%<%<%<%<%<%<%<%<%<%>+93 A3 F5 I;KEJPI\GhFtD C"B#B$A%A&@&@'@'?'?(?(>(>(>(>(>(>'>'>'>'>'>'?+<2C1 I3 M: ODNNMZKfIrH|!G#F%E&D'D(C)C*B*B+B+A+A,A,A,A,A+A*A*A*A*A*A*?*?0G/ L0 Q8 SBSLQWOcNo Ly#K&J(I)H+G,G-F-F.E/E/D0D0D1C1C1D/D.D.D.D.D.D.@*B.J, Q. V6 X@YJWTU_Sk"Qv%P(N+M-L/K0J1I3I4H4H5G6F7F7F7G6G4H3H3H3H3H3H3A)E+N)V, [4 ^=^G]Q[[Yg#Wr(U|,S/Q2P4O6N7M9L:K;J=I>I?H?I=J;K9L7L7L7L7L7L7B)I(R&Z* `2 c:dDcMaW_c%\n*Zx/X3V7T:RO@NBMDLFJGJHKFMCNAO>Pb{D`H]K\NZQXSWUVVVWUXUXWTYP[M]J]J]J]J]J]JJ#Wbk"r(w/ y6 z>zGwT$s^/ng8ko?hwEe}JbN`Q^T]V[XZZY[Y\Y\[Y]T_PaMaMaMaMaMaML!Yeo v&{,~3 :ހD}P#x[/sd8pl@lsFizKgOeScVaY`[^]]^]_]`^]aXcTdPdPdPdPdPdPO\hry#)/6 مAсN"|X.xa8ti@qpFnwLk}PiTgWeZd]b_aaab`cb`d[fWhShShShShShSQ^kt|!%+ދ1 Ԋ>ͅK!ƁV-|_7xg@unFrtLozQmUkXi\h^faeceddeech^jYkUkUkUkUkUkUS`mw!&ڐ-Ў<ɉI …T,]6|d?ykFvqLswQq}UoYm\l_jbidhfhfifk`m[oWoWoWoWoWoWUboy Ք*͑:ōGR+[6b>}iFzoLwuQu{UsYq]o`ncmelglglgoaq\rXrXrXrXrXrXWeq|ݔҗ(ɕ8‘EP*Y5`>gE~mK{sPyyUwYu]s`rcqfphphphrct^vZvZvZvZvZvZYgt~٘ Κ%Ƙ6CN)W4_=eDkKqP}wU{}Yy]xavduf~th|ti{ti}vdx_y[y[y[y[y[y[[i v ٔӛ ˞#œ4 AL'U2]cEiK}oPytUtzYp]l`icfedecedcf^h[h[h[h[h[h[fvԏ̙ţ)8CL)T2[:aA|gGwlMsrQnxVjYf]c_`a^b]b]`_\aYaYaYaYaYaYkzۇϓǞ %4@J$R.Y6{_=veCqjHmpMhvQd~UaX]ZZ\X]W]W[YXZVZVZVZVZVZVpԍʙ 0 <FO(yV0t\7ob=khBfnFbuJ_|N[QXSUUSVRVRUSRTPTPTPTPTPTPvۆ͓Ġ+8~CwK"rS)mZ/h`5df:`l>]sBY{EV„HSJPŸLN³LMLMKNJNINININININI~ҍǛ $z3 t>oHjP eW&a^+^d/Zk3Wr7Sz:PуKџ@JҳAI@I@H?H?H?H?H?H?H?نʖxt o.j9 eCaL]SZZ!Va$Sh(Qo*Nw-K/I1G2E3D4C3C3B3B3B3B3B3B3ΐ voj"e.`8 [@WGSOPVN\KcIjFq!Dz#B%@&>'='<(;(;(;(;(;(;(;(Ĝuje`!Z+V4 Q< MCJJGPDVB\?c=j:r8{64321000000th_ZTO'J/F7C= ?C ):0653:/@,E )J 'O $U !\ c k t ~ufYNGA;61!-'),%1!5:>CIO V] e m u } 3.0373;6 <; =E{==<;;;: : : 9 9!9!9!9 9 9 9999995-9.@-E/ I7 K@JJIVGbEmDxBA@!@!?"?#>#>$>$=%=%=%=%=%=%=$=#=#=#=#=#=#6,=+D*J+O4 Q> QHNRM^KiItH~!G"E$E%D&C'C(B)B)A*A+A+@+@+A*A)A(A'A'A'A'A'7,A(I&O)U2 W; WDUOSYQeOp My#L&K(I*I,H-G.F/E0E1D2D3C3D1E0F.F-G,G,G,G,G,:*E%M"U'Z/ ]8 ]A\KYUWaUl"Su'Q~*P-N/M2K3J5I7H8G:G:G;G:H8I6J4K2K1K1K1K1K1>'I!QZ%`,c4 c=bG`Q^\\g$Yq*Vy.T2R6P8O:NN;O9P7P6P6P6P6P6A$LV_#e)h1 i: iCgLeXbc&_l,\u2Y|6W:UT;U;U;U;U;U;D"PZc i'm.o5 o>mHkTh_&dh.ap4^x9\_B]E\HZJYLXNWOWPWPWOZJ[G]C]B]B]B]B]BJVbjq!v&y,z4 z@vMrX&oa.ki5ip;fw@d}DbG`J_L^O\Q[R[S[T[S]N_JaFaEaEaEaEaELYdnuz"}'݀.~={JwU%s^.pf6mmlDrH}xL|~PzT|yWyxZvw\tw]sw]sx[uyVwzQw{Pw{Pw{Pw{Pw{P[ iuԈ͏Ȗ-;FO'W0^7e=jCpGvL}|PzSv~Ws}Zp|\n|]m|]m}[o~VqRrQrQrQrQrQ^lxقЋɓ™*8DM%U.\5cHP(X/}^6yd]zAYEVGSIQJPJPJPHQFQEQEQEQEQEuԄɑ #~2x=sGnOiV$e])ac.^j2Zq5Wx9TN@LAKAK@K?K>K>K>K>K>K>}͋™|ws+n8 jBeKaS^Z Za$Wg'To+Qv.N1K̋3I̙4G̬5F5E5E5E5E4E4E4E4E4҆Ɣ}ri g"c1`= \F YOUVR]PdMlJt"H}$E݈&Cޖ'Bި(@߾(@(?(>)>)>)>)>)>)ɐ}qf`]#Y.U8QA NI KPHWF^DfAn?v=;9876555555}pe[WS!O,K4G<DC AJ >P AI @T>`&C)G2I< IE FPD\CgAr@{?>==<<;;;; : : : : :;;;;;;3)<$C#I&N/P8 OB NLKWIcGmFwEDC!B"A#A$@$@%?&?&?'>'?&?%@$@#A"A"A"A"A"7&@!GO$T,V5 V> UHRSP^NiMrK{!J#H%G'F)E*E+D,C-C.C.C/C-D+E*F(F'F'F'F'F';#DLU!Z)\1]: \DYNWZUdSn!Qv%O~(M+L-K.J0I1I2H3H4G5G5H4I1J/K-K,K,K,K,K,> HQZ_&b-c6b? `I^U\`Yi#Vr(Ty+S/Q1P3O5N6M8M9L:L;L;L:N7O4P2P1P1P1P1P1BLV^d"g)h1h: gDeQb[_e$\m*Zu.X|2W4U7T9S;RQ?P@PAP@RW@VBUCTDTETEVAX=Y:Z8Z8Z8Z8Z8GR ^flpr%s-s< pImTi^%gf,dm1bt5az9_<]>\A[CZEYGYHXIXIZE\A]>^;^;^;^;^;JU aiotvx(w9 tFqQn[%kc,ij1gq6ew:c}=b@`C_E^G]I]K\K\L^H_Da@b>b>b>b>b>LX d l rwz|%{6 yCuOrX%p`,mg1kn6it:hz>fAeDcFbIaK`M`N`NaKcFdCe@e@e@e@e@O[f n u z} "3|AyLvV$t^+qe1ok6mq:kw>j}AiDgGfJeLdNdOdPeMgHhDiBiBiBiBiBQ ]hqw|Ҁʃ‚1?}JzS#w\*uc1si6qo:ou>n{AlEkHjKiMhOhPhQhOjJkFlClClClClCS _jsz΃Ɔ/=H~Q"{Z*ya0wg5um9ss=ryApEoHnKmNlP}lQ|lR{lP}nK~oGpDpDpDpDpDUbmu}ςʆ‰,:FO!X)}_/{e4yk9wq=vwAu}EsHrK|qNzpPxpRvpRvpQwrLysHzsEzsEzsEzsEzsEWdox˅Ŋ*8 DM V'].c4~i8|o=zuAy{E}xHzwKwvNtuPrtRptRptRrvMswItwFtwFtwFtwFtwFYgr{΃lj'6 BKT&[-a2g7m<~s@{~zDx}Ht|Kq{NozPlzQkyRjzRl{Mm|Io|Fo|Fo|Fo|Fo|F\ju~ʆÌ $3 ?IQ$Y+_1e6}k;yq?uxCrFoJlMiOgPeQdPfLgIiFiFiFiFiF_mxςƊ 0<FO!V(].{c4wi8to=puAl}DiHfKcMaN_O^N`KaGbEbEbEbEbEcq}ˆ,9DL~T%y[+ua0qg5nm9js=g{AcD`G]I[KYKXKYH[E\C\C\C\C\ChvЁƌ(5 @}IxQ!sX'o^,ke0hk5dq9ay<]?ZBWDUFSFSFSDTBU@U@U@U@U@m{ʇ "1{<uFqNlU!h\&eb*ai.^o2Zw6W9T;Q=O?N?M?M>Na :7%4-04-:*@(F%M"U]fp|        |l^QF<72 .*'%#*06;AH PXblx~n_PD80*%!  %*/5;BIR\fq|3#/'/'2%7&C%O #\ "g s }                       1&-*-+/+6,A+M )Y 'e %p $z $$#####" " " " " " " " " ! ! ! ! ! ! ".*+/*0,142?1J /V -b +m*w*)))((((((('''' ' ''''''',/(3'5(929<8G 6R 4^ 3i1t0}0///......-----------,)3%8#<&@/A9@C >O }=<<;;:::999999::::::3#<BI!N)O2O;ME JPI\GfFpDxCBAA@@ ?!?">">#>#>#?"?!@ @@@@@8@GOT%V-V6T@ RK PWNbMkKtI{H G"F$F%E&D'D(D)C)C*C*D(E&E%F#F#F#F#F#;DMUY!\)\1[;YE WRU]SfQoOv"N}$M&L(K*J+J-I.I/H0H0H0I.J+K)K(K'K'K'K'?HRY^a$b+a4`@ ^M\XYbWj Ur$Tx'S*Q,P.O0O1N3M4M5M6L6N3O0P.P,P+P+P+P+BK V]bef$f,f<dIaT_^]f"[n&Yt*X{,V/U1T3S5S7R8Q9Q:Q:R8S4T2U/U/U/U/U/ENY afijl'k8iEgQdZbc#`j'^q+]w.[}1Z3Y6X8W:V;V=U>U>VZ?YAYAZ@\;]8^5^4^4^4^4J U_gloqt t2r? pKmTk]#id(gj,eq0dw3c}6a9`;_>^@^A]C]C^C_>a:a7b6b6b6b6LWbiosuwx/v= tHqRoZ"ma'kh,in0ht3gz6e9d{l;{l:{l:{l:{l:R_iqw|'6 B}K{T y[%wb*uh/tm2rs6qz:p=|o@ynCwnEumGsmGrmGtnCuo?vpi~Ag}Cd}Ec}Fb}Fb}Cd~?e~_;_;_;_;_;bozƃ&4?~HyPuW!q]&nc*kj.gp2dw6a9^<[>Y@W@V@V?W!> = =!t<~:ы8ћ7Ѱ65433333tg\QHA@ >,=7;A:I8R7Z5c3m1w / . , + * * ) ) ) ) ) ug[PF<974(2109.A,I*Q(Y%b#l!xvh[NC93/ ,)"&)#0 7>EMV` k w xiZMA6-(# &, 29@HQ\gtzj[M?3(!  &,2:BLVbnz0--/5ANZfq{. +"*!, 3 ?KWcnx   +$('(')(1(<&H$T"` k u ~         "()&,$-&0/09/D-Q*\ )g 'q &z & & & % % % % % % $ $ $ $ $ $ $ $ $ $ $ $ '&-"1 4#8,967A5L3X 1c /m .v .~ . - - - , , , , , , , , ,++++++++#26< @)A2@<=G;S 9^ 8h 7r 6z5544443333233333333307<CG%H.G8EBCN AY ?d >m=u=}<;;:::99999999999994;BIM!O)N2L=JGHT G_ FhEqCxCBAA@@???>> ??@@@@@@8? HOST$T,S6QBPN NZMcKlJsIzHGG F!E"E#D$D%D&D&D%E#E!F FFFF;CM TXYY%X.X<WJ UUS_RgPnOuN{ M"L$K%K'J(I)I*I+I,I*J(K&K$K#K#K#K#? GQX \]]^'^8]F [QYZWcVjTq Sw#R}%Q'P)P+O,N.N/M0M0N/O,P)P'P&P&P&P&B KU[_a a c"d4bB `M^W]_[fZm"Xs%Wy'V)U+T-S/S1R2R3R4R4S0T-U+U)U)U)U)DNX^beegh0g> eJcTa\`c^j"]p&\v([|+Z-Y/X1W3W5V6V7V7X3Y0Y-Y,Y,Y,Y,FQ[afiikl-k;jGhQfYd`cg#am&`s)_y,^.]1\3[5[7Z8Z9Z9\5]2]/^-^-^-^-IT]dimmop*o9nDlNjVh^gd#ej&dp)cv,b}/a2`4_6_8^:^;^;_7`4a1a/a/a/a/KV`gmpqrt's6rB pLnTl[jb"ih&hn)gt,fz/e2d5c7c9}b;{b!>!>!>!zxk^YV T-R8PAMJKRIY Ga DiBr?}=;:98776666ă{nbVKGE"D.B8AB?J=S<[:d8n6x 4˅ 2˔ 1˧ 0̿ / .-----}pcWLB842 1,06/@.I-R,\*f)q'~&݌$ޟ#޷"!!    qcWKA6-) '%%#.!6?HQ[fr     sdVJ>4*# %-4 <DNXdqteVI<1& "(/7?ITan}wgWI;."")1:DP]jw.++- 3 ? LYdoy+((*1=IV a l v      (%%&/:FR^is{&##$!$#',&7$B"N Zeox##')- 0)03.>+J)U'`&j%s%{$$$############# " " " " ',/58&8/794E2P0[/f.o-w-~-,,,, , + + + + + + + + + + + + + +16<?!@*>4e >m =u <{<;;::::99999::::::4:B HKLK&I0H>HKGVF` EhDoCvB|BAA@@??????@@@@@@8 >GM PQON(O8OFNQ M[ LcJkIqIwH~GGFEE E!D!D"D"E FFFFFF;CLQTT SU"V4VBTM SWR_PgOmNsMyMLK!K"J$J%I&I'I'J$K"K KKKK>GPUXYXZ\0[>ZI YSW[VcUiToSuR{ Q"P$O%O'N(N*N*N+O(P%P#P!P!P!P!@JSX\^]_a,`:_F ^P\X[_YfXlWrVx!V~$U&T(S)S+S,R-R.S+T(U&U$U$U$U$CMU\acbce)e7cC bM`U_\^c]i\o [u"Z{%Y'X)X+W-W.W/W0W.X*Y(Y%Y%Y%Y%EPX`dgfgi%i4h@ fJeScZb`af`l _r#^x%](\*\,[.[0~[1|[1|[0}\,}])}]'}]'}]'}]'GS[chjjk l"l1k>jH iPgWf^eddj cp"bv%a}(`+}`-{_/y_1x_2w_3v_1w`-w`*xa(xa(xa(xa(IU_fknnn pp/o;nE lNkUj\ibgggm"ft%}e{(zd+xd.vc0tc2rc3qc3qc2rd.rd+sd)sd)sd)sd)LWbinqrrst,s9rC qKoSnZm`le|kl"zjr%xiy(ui+sh.qg0og2mg3lg4lg3mh/mh,nh*nh*nh*nh*OZelruvvwx)w6v@ uIsQrX}q^zpdxoj"uop%snw(pm+nm.ll0jk2hk3gk3fl3gl/hl,il*il*il*il*R^hpuxzz{|&{3{> yGxO|wVyv\vubsth!ptn$nsu'kr}*ir-fq/dp1cp2ap3ap3bq/bq,cq*cq*cq*cq*Ublsy}~~#0;~D z~Lw}St|Zq{`nzf kym#iyt&fx|)cw,aw._v0]v1\v2[v1\v.]v,]v*]v*]v*]v*Yfpx} -}8yA uIqQnWk^idfj!cq$`y'^~*[},Y}.W}/V}/U}/V}-V|*W|)W|)W|)W|)^kt|}ICC_PROFILE~z(v4r>oF kNhTe[ca`h]o!Zw$W&U)S+Q,O,O+O*P(P'P'P'P'dpz|vr"n/k:hB eJ bQ_X\_YfVmTuQ"N$L&J'I'H'H&I%I$I$I$I$jvslhe)b4_>]FZN WUU\RcOkMsJ}HED B B A AAAAAq}|mb]Z!X.V8SAQIOQLX J` HhEpCz@><;;:99999ysfYQMK$I0G:FCDKBS@[>d;9%8/796B4K3T2]0g.r,~+ō)Ɵ(Ƶ'&& % % % % zl_SG=2*'%"$,#6!? IS^ivօ֘ׯ|m`SG;1' !+4 = G R]jxo`SF:/$ !)2:DO\ixqbSE8, %-6@LYhwtdTE7* '1;HVds + ( (*1=JWcnw (%% &.:GS_jt}%"!"+7D P\gpy")4@LWblu}            !"%'&&0#;!GR^hpx#&(-/"/+-6*A(M&X%c$l$t#{##""""""""""##"""""(+ / 577&502;0G.S.]-g-o-v,},,,,,,+++ + + + + + + + + + , /6;==;)837@6L6X6a6j5q5w5} 4 4 4 4 3 3 3333333333304<ACB@=*>9?G?S?\>e=l =r FJLLI LM/N>MIMS L\ KcJiIoHuH{GFFEEEEEEFFFFFF9BJNRRPRS+T:SERO QX P_OeNkNqMwL}LKKJJ J!J"J!KKKKKK<FMSWXVWX'Y6XBWL VT U\TbShSnRtQzQPO O"O#N$N%O$P!PPPPP?IQX\][[]$^3]?\I [Q ZXY_XeWkVqVwU~T T"S$S%S&S'~S&~T#~T ~U~U~U~UAKU[`a`` a b0a<`F _N ^V]\\b[h[nZtY{Y!X#}X%{W'yW(xW(xW(xX%xX"xY xYxYxYDNX_ceddef-e9dCcL bSaZ``_f_k^r}]y{]!y\$w\&u[(t[)s[)r[)r\&s\#s]!s] s] s] FQ[bgihhii*i6hAgI fQeWd]~cc|cizbpxawva~"t`$r`&p_(n_)m_*l_*m`'m`$n`"n`!n`!n`!IU^ejllklm'm4l>kG jOiU}h[zgaxggvfnsfuqe}"od$md'kd(ic*hc*gd*hd'hd$id#id"id"id"LXbimppopq$q1p<oE ~oL {nSxmYul`skfqklojslj{!ji$hh&fh(dh*ch*bh*ch'ch%dh#dh"dh"dh"O\elqtust u u.u9}tBzsJ vsQsrWqq^npdlpjjoqgoy!en#cm&`m(_m)]m*]m)]m'^m%^m#_m"_m"_m"S_ipuxyxyzz+|z6xy?tyH qxOnwUlw\ivbguhduobtw_t"]s$[s&Yr(Xr(Wr(Wr&Xr$Xr"Yr"Yr"Yr"Wdmtz}~}~~z&v2r<oD l~L i~Sf}Yd}_a|f_{m\{uZz~ Wz"Uy$Sy%Ry&Qy&Qy$Rx"Rx!Rx Rx Rx ]iry}vr!o.l8hAeI cP `V^][dYkVsS|QO!M"K"K"J!K KKKKbnwun jg)d4a=^E\L YS WZTaRhOqMzJHFEDDDDDDDit~~oe`]"Z.X8V@SHQOOV M^ JfHnExCA?>=<<<<<<p{wi]UQO&M1K:ICHJFRDZAb?k =u ;9765443333x}obUJD A?(>2<;;C:L8T7]5g3q1}/-,++* ) ) ) ) seYMA71/-',0+:*C)L'V&`%k#w" vh[NB7-# #,6@JUa n } ύϢλyj\OB7,!  !*4>IUbpހޒާ߿{l]OB5) (1<GTbq~n^OA4'$-8DRapq`PA3%  )4AP_n}(%%'.;HUalu}$"!#,8EQ]hrz !  )4AMYdnv~&1 <IU`iry#,7DO[ e m u |       $&%("2>JU_hpw}" $(--,!*+'7$C"O"Y"c"k#r#x#~#################')0443/#,.+;,H-T-^-f-m-s-y--,,,,,,,,, , , , , , , *.69:8 42%456C6O6X6a6h6n5t5z54 4 4 4 4 4 3 3 4 4 4 4 3 3 3 .4;>><8 ;=0?>?J?T>\>c=j=p >>>>>hs{yj_W TR&P1N:LBJIHQFXD`Bi @r =~ ;:87766666oyseXMHFD)B3A;?C>K2( %.8CNZftDŽƗƭufXK>2'%.7BN[ix։֝ճxhYK=1$ "+5@M[jz{k[L=/" '2>K[j{~m]M=/  #.;JZjz$""$+9FS_iqz!(5BO[fnv~%1>KVbjrz  !-9FR]fnu|  ( 4@LWaiqw} #.: F Q [ d l s y  !$#!'2>JU_gntz!")+*'#( 7!D"P#Y#a$i$o$u$z$$$$$$$$$$$$$$$$%)/0/+&(!+1,>-J.T.\.d.j.p.v.{---------------(/4685024,596E7O7X6_6e6k6q5w5}555 4 4 4 4 4 5 5 5 4 4 4 ,49>@?9:<'=5>@>K>S>[=a=g=mV{ET{LR{SP{ZNza Kzi Izr Gy}EyCyByAy@y@x@w@v@v@v`jry}yl`Y US&Q0O9MALHJOHVF^DfBp @{ > < :98 888~8~8~gpxtfZPKIG*E3C;BC@J?R=Z;c9m7x53 2 1 0 0 / / / / nw|n`TI@<:"8+746<4D3M2U0_.i-t+)(&%%%%%%vtfYLA7. +*"(+'4%<$E#N!X co}yk]PD8-# )2;E P \ hv}n`SF9.#   )2<GR_m|qbTG:-"  (1<GTbqρϔΪοteVG9, %/:FUdtwgXH9+!+7EUewzjZJ:+ (5DTew!!)7CP[fow~&3?LWbksz".;HS^gov| *6CNYbkrx~ %0=HS]fmsy~  *6BMW`hntz " -: F Q Z b i o u z !" $3@KU]djpv{#'''# !-#:$F$O%X%_%e%k%q&v&|&&&&&&&&&&&&&&")-12/))+'-5-@.J.S/Z/a/g/l/r.x.~......../....&-5:;9414"506<6F7N7V7\6b6h6n6t6z66555 5 5 6 6 6 6 5 5 *3<ABA<9 ;<+=7>B>J>R=X=^=d=j=pDFDNCUC[C`BfBlBs~Bz }B {A zA xAwAvAuBuB tB tB tA tA 2>FKNMIFFH#H0I:ICIKIQHW~H]|Hc{GiyGp wGw vG tG sFqFpFoFnGnGnGnG nF nF 6BJPRROKKLM,M7N@MH|MNzMTxLZvL`tLfsLm qLt pK} nKmKkKjKiKhKhKhKhKhKhK:FNSVVTPP QQ)R4|R=yREwQLtQRrQXpQ^oPdmPk lPr jP{ iPgPfOdOcPcPcPcPcOcOcO>JRWZ[YTTU~U&zV1wV:tVBqUIoUOmUUkU[jUbhUh gTp eTy cTbT`T_T^T]T^T^T^S^S^SBMU[^^]YY}YxZ"uZ.rZ7oZ?lZFjZMhYSgYYeY`dYg bYn `Yw ^X]X[XZXYXXXXXYXYWYWYWFQY^acb]]w]s^o^*l^4j^=h^Df^Kd^Qb^W`^^_^e ]^l []u Y]X]V]U]T]S]S\S\T\T\T\JU\begfbybrb mcjc'gc1ec:ccBacI_cO]cU[c\ZccXck Vbs Tb}RbPbObNbMbMaNaN`N`N`NYafjkkhtglgghdh#ai._i7]i?\iFZiMXiSViZThaRhi Phq Nh| LgKgIgHgGgGgHfHfHeHeS]ekoqq{npnfm`n]n[o*Yo3Wo;UoCSoJRoPPoWNo^LnfJno Hnz Fn Dn CmBmAmAmAl Ak Ak Ak XbjptvwxuluatYt UuSu%Qv/Ov7Nv?LvFKvMIvTGv\EvdCumAuw?u =u GQ\hv  }ugYL?3) ",5?IUan}yj\NA4($,6@KXft}n_PB5(#,5@M[jzɌɢȸqaRC5'  *4@N^nߒߨ޼tdTD5'&2@P`qwgWF6& "0?Qbt&4?MYclt{#0<IU_hpw} +7DP[dlsy~ &2?KV_gntz  ,9EPZbiouz%2?JT\djpuz  *7CNV^ekpu{ ! / < G PX_fkqv|"!)6AKSZaflqw}!(,,)# "#$0%<&F&N&U'\'b'g'm's'y''''((((((((( )1553.) +-+.7/A/I/Q/W/]0c0i0o0u0|0000000~0}0}0}0}0$08<=;7234&526<6E7M7S7Y7_7e7k7q6x6}6|6z6y6x7w7v7u7u6u6u6*6=BDB>99;"<.=8=A=I=P=V=\}=a{=gz=nx=uw<}u<t<r<q< p= o= o= n=n<n<n</;BGIHD@? @A*B5B>~CE|BLzBRxBXvB^tBdsBkqBrpBznBmB lB jB iB iB hB hB hB hA hA 4?GKNMJFEEF'}G1zG:xGBuGIsGOqGUpG[nGamGhkGojGxhG gG fG dG cG cG bG bG bF bF bF 8CKPRROKJJ{K#xK.tK7rK?pLFnLLlKRjKXiK_gKffKmdKvcK aK `K _K ^K ]K ]K ]K ]K ]K ]K <GNSVVTPNzNvO rO+oP4lP<jPChPJfOPePVcP\bPcaPk_Pt^P} \P [P YP XP XP XP XO XO XO XO @JRWZZYT|SuS pSmT(jT1gT9eTAcTGbTN`TT_T[]Tb\TiZTrYT| WT VT TT ST ST RT SS SS SS SS DNV[^_]YwWpW kXgX$eY.bY7`Y>_YE]YL[YRZYYXY`WYgUYpSYz RY PY OY NY MY MX MX MW NW NW HRZ_bcb}^s]k\e]b]!_]+]^4[^<Y^CX^IV^PU^WS^^Q^eP^nN^xL^ K^ I^ H^ G^ G] H] H\ H\ H\ LV^cfhgzdpceb_b\cYc'Wc0Ud8Td@RdGQdNOdTMd\LdcJdlHcvFcEc Cc Bc Ac Ac Ab Ba Ba Ba Q[bhkmmwkljaiYh UiRi#Pi-Nj5Mj<LjDJjKIjRGjYEjaCjjBjt@j>iq^0# &/:FTcsąÚ±}n^N?0" $.9HWgyٌ٢ظqaP@1" !,:IZk~tdSB2"+:K]o$/=JV`iqx~ +9FR\emtz '4AMXaiouz "/<GR\djpv{)6BMV^ekqv{#0<FPX`flqv{ (5@JRZaflqv{ ,9CLT[aglqw|    %1<FNU\aglrx$''# ,7AIPW]bhnt { !!!""""!%,00-)"#%&&2'<'D(L(R(X(^(c)i)p)w))~)}){*z*y*x*w*w*w*w*!,48862,+-!.-/7/@0G0N0T0Z~0`}0e{0lz1sx1{w1u1t1s1r1q1p1o1o1o1o1'2:>?>952 34)536<~6C|6Jz6Px7Vv7\u7bs7hr7pq7xo7n7l7k7j7i8i8h7h7h7h7-7?CED@<99:%|;/y<8w<@t~?z?!v@+s@5pA<nAClAJjAPiAVhA\fBceBjdBrbB|aB`B^B]B]B\B\B\B\A\A6@GLNNKGDxCtDpE(mE1jE9hE@fFGdFMcFSbFYaF`_Fh^Gp]Gz[GZGYGXGWGVGVGWFWFWF:DKPRRPLzIsH nIjI%gI.eJ6cJ=`JD_JJ^JP]JW[K^ZKfYKnWKxVKUKSKRKRKQKQKQJRJRJ>HOTVVUQvNnMiMeN"bN+`N3]N;\NAZOHYONXOUVO\UOdTPmRPvQPOPNPMPLPLPLOLOMNMNBLSWZ[Y}UrSiRcR`R]S(ZS1XS8WS?USFTTMSTSQTZPTbOTkMTuKTJTITGTGTFTGSGSGSGRFPW[^_^yZoYdW]W ZWWX%UX.SX5QY=PYCOYJMYQLYXJY`IYiGYsFY~DYCYBYAY@YAXAXAWAWJT[`cddval`a^X]S]Q]!O^*M^2K^:J^AI_HG_OF_VD_^C_gA_q@_|>_=_;_;_:_:^;];\;\PY`ehjisgif]eQcLcJdGd&Fd.De6Ce=AeD@eL?eS>e[!}G}P}Z}e}q|||{{zyxxirx~~pbTG;0&'/7@J U `m{qzwhZL?3( (1:DO[guz|n_QC6*"*3<GSaorcTF8+"*4>KXgvvgWH:, )4@N]m~zjZJ;,  (3AQasӆҜҲ~n]M<, &3CTfyqaP?.  %4EXj}-;HS^fntz )6COYbjpv{ $1>JT]ekqw|,9DOX`gmrw| '3?IRZagmrw{ -8CLU\bgmqv{&2<FOV\bglqv| *5?HPW]bglqw} !.8B J Q W ] b g m s y  ""'2<DKRX]chnu}~}|{zyyy"(,+($!,6 ? F!M!S!Y!^!d}"j|"qz"yy"w#v#u#t#s#r$q$p$p$p$)0342-($ %&'(2(:)B})H{)Oy)Tw)Zv*`t*fs*mr*up+o+n+l+k+j+j,i,i,h+h+%/6:;950,,-#|.-y/6w0>u0Es0Kq0Qo0Vn1]l1ck1jj1ri1|g2f2e2d2c2b2b2b2a2b2*5;?A?;83}2y4u4)r52o5:m6Ak6Gj6Mh6Sg6Ye7`d7gc7pb7y`8_8^8]8\8\8[8[8[7[7/9@DFEA>~:w8 r9n:&k:/i;6g;=e;Dc;Jb;P`;V_<]^DHJJGCy?q>l>h?"e?+c?3a?:_@A]@G[@MZ@TYA[XAbWAkVBuUBSBRBQBPBPBPBPAPAPA8AHLNNLHuElCgCcC`D(]D0[D7YD>WDDVDJUEQTEYSF`RFiQFsOF~NFMFLFKGJGJFKFKEKE<ELPSSQ|MqJgHaG]HZH%XH-UH5TI<RIBQIHPJOOJWNJ_MKgKKqJK|IKGKFKEKEKEJEJFIFI@IPTWWVxRmPcM\M XMUM"RM+PM2ON9MN@LNFKNMJOUHO]GOeFPoDPzCPBPAP@P?P?O@N@N@NDMTX[\[uWjV`TWRRRORMS(KS/IS6HS=FSDETKDTRCTZAUc@Um?Ux=UZP7`E6`M5`V3`_2`i0`t/`.`,`+`+`+_+^,^,]S\cgklzlmkbjUhIg>f8f6f4f$3f+1g30g:/gB-gJ,gR+g\)gf'gr&g$g#g"g!f!f"e#d#dZbhmqsxsjr]qPpDo9n/n,n*n(n&'o.%o5$o=#oE!oN oXocooo|onnmmlkk`iotxzszeyWxJw>w3w(w w wxx(x/x7x@xIxSx_ wk wy wvuutssshpv{{m^PC7,!  )1:DNZft~}||{{px~seVH;/# #+4>HTao~yyj\M?1%  %-6AMZhx~o`QB4&  %-7DQ`osdTD5' #-9GVfwwgWG7( "-;J[l͕ͭ{kZI9( ,=N`s~n^M;*-?Rey *8EPZcjqw|}ICC_PROFILE&3@LV_fmrx}!.;FQZahnsx} )5AKT\cinsx}$0;EOW^dinrw|)5?HQX^chmrw|#.9BJRX^chmrw} '2;DLRX]bgmrx *4=ELRX]bhmt{~}|||   " - 7 ?FMRX]cip~w|{yxvutssrr%''$ '1:AH}N{SzYx_weultsr|qonmlkjjjj&,/0-)$"} ,z!5x"<v"Ct#Ir#Op#Uo#[m#al$hk$pi$yh$g%e%d%c%c&b&b&b&b%",36751-'}%x'u((r(0o)8m)?l*Ej*Kh*Qg*We*^d+ec+ma+v`,_,^,],\-[-[-[-[,[,(28<=;84~/v, q-m.$k/,h/4f/;d0Bb0Ga0M_0T^1Z]1b\1j[2sY2~X2W2V3U3T3T3T2T2T2-6=ABA>:x6p3k3g3 d4)a41_58]5>\5DZ5JY6QX6XW6_U7hT7qS7|R8Q8P8O8N8N8N8N7O71;AEGFC~@t<j8e8a9^9&[9.Y94W:;U:AT:GS:NR;UQ;]P_= [=X>"U>+S>2Q>8O>>N?EM?LL@SK@[J@cIAmHAxGAFADADBCBCACAD@D@:CIMOOMwJlGbDZBVBRBPC(NC/LC6JC<IDCHDIGDQFEYEEbDEkBFvAF@F?F>F=F=F>E>E?D>GMQTTRtOiM_JUHPGMGJH%HH,FH3EH:DI@BIGAIO@JW?J`>Ji=Ku;K:K9K8K7K8J8J9I9IBKQVXY~XqTgS\QQNJM GMDM!BM)AN0?N7>N>=NE;OL:OU9O]8Pg6Ps5P4P3P2P1P1O2N2N3MGPVZ]^|]nZdYZWNUDS@S>S|H|S{`{mz|yyxwvvuov|paSD7* '/8BNZhwwvgXI;-  '0:FSaq{l\M>0!(1=JYhzp`PA1" '2@O_ptdTC3#'4CTexȎǧƾxhWF5$ '6GYl{k[I8& '9L`s '4AMW_gnsy~#0<HR[cioty~+7BMV^djpuy~ &1=GPX_ejoty~ ,7AJSZ`ejnsx} &1;DLSZ_dinsx~ +5>FMTY_chmrx $.7?GNTY^chmsz  '09AHNSX^chov~}{yxwvvuu )2:AHNS~X|^zdyjw ru zt r q o n m l l l l !##   ",}4z<xBvHuNsTqYp`nfmnkwjhgfedcccc#),,)% ~zv's/q7o>mDkJjOhUg\ecdkbsa~`^]\[[ [ [[ )/231-)~$v q n!"k"+h"3f#9e#@c$Fa$K`$R^$X]%_\%gZ%pY&{X&W&U&T'T'S'S'S'T&&/589840x,o'j'f(c('a)/_)5]*<[*BZ*HX*NW+UV+\T+dS,nR,xQ,P-N-M-M-L-M-M-M,+4:=>=:}7s3j.c- `-].#Z.+X/2V/8T/?S/EQ0KP0RO1ZN1bM1kL2vJ2I2H2G3F3F3G2G2G2/8>BCC@y<o9e5^3 Y3V3 T3(Q3/O45N4;L4BK5HJ5OI6WH6`G6iF7tD7C7B8A8@8@8A7A7B64<BFHGEvBk>a:Y8T8P8N8%K8,I82G88F9?E9FD:MC:UB;^A;h@<=<<<;<;<;<<;<;8@FJLL~JsGhD^AT=N=K=H="F=)D=0B=6A>=@>D??K>?S=@\;@f:@q9A}8A7A6A5A5A6@6@7?<DJNQQ|OoLeJ[GQDIB EBBB@B&>B-=C4;C::DA9DI8DQ7EZ6Ed4Eo3E|2E1F0F/E/E0E0D1D@IOSUVzUmQcPYNNKCH?GIRZ`fkpuz".9CLT[afkpuz(3=FNU[aejoty"-7@HOU[`einsy'09AIOUZ_dintz *3;BIOTY^ciou}}|{zzz #,5<CINTY^d~j|qzxxvusrppooo %.6~=|CzIyNwTvYt_reqloum~ljigfeeee   |y'v /s 7q =p Cn Im Nk Ti Zh af ie qc{b`_^]\\\\ %((%"w ro!l*j1h8f>dDcJaP`V^]]e[nZxYWVUTSSST',//-*&x!pjgd%a-_4]:\@ZFYLWSVZTbSkR uP O N M!L!L!L!L!L $,25641|-s)j$c! _!\"!Z#)W#0V#6T$<R$BQ$IP%ON%WM%_L&hK&sI'H'G'F'E'E'E'E'F')17:;:7x4n0e+](X'U(S(%P),N)3M)9K*?J*EI*LH+TF+]E,fD,qC,}A-@-?->->-?-?-?,-6;?@?=t9j6a2W.R-O-L-"J.)H./F.6E.<C/CB/JA0R@0Z?1d>1o=2{;2:29282829291:12:@CED|Bq?g;]8S4M2 I2F2D2&A3,?32>39=4@<4G;5O:5X96b86m76y67473727273646456>DGIIzGnDdAZ>P:G8C7@7>7#<8*:8098789>79E6:M4:V3;`2;k1;x/;.;-;,;,;-;.:.::BHLNNxLkIbGXDMAC==<:=8= 6='5=.3>52><1>C/?K.?T-@^,@i*@v)@(@'@&@%@&?'?(>>FLPRSvRiO`MVKKH@E7B 4B2C0C$.C+-C2,D9*DA)DI'ER&E\%Eg#Et"F!EEEED D!CCKQUW~XtWgU^TTRHO=L2I-I+I)I!'I(&J/$J6#J>!JF KOKZKeKrKKKKJJIIIPVZ]|^r]f\\[PXDV9S-Q%P "P PP$P,Q3Q;QCQMQWQbQoQ~ Q Q P P O O NNV\`czdpddcXaL_?]4[)YXXXX X'X/ X7 X@ XIXTX_XlXzWWVVUUTU\bfixknk`iSgFf:d.c#ba ````#`+`3`<`F`Q`\_i_w^^]\\[[\cimpwrjq[oMn@m3l'kjjjjji i'i/i8iBhLhXhegsgfedccbdkpu~wqxcwTvEu8u+ttttts sss#s*s3r=rHrTqapoponmlkklsx|y~j~[~L}=}/}"}}}~~~~ ~~~$},}6}B|N{[{jzzyxwvutu{paQB3$ %/:GUdt~ufVF6' &1>L\mzjZI9)&3BRcv~n^M<+'7GYlrbQ?- ):M`u׋֣չvfUC0 -@Th} -:EOX_flqv{ (4@JS[aglqv{$/:ENU\bglqv{*5?HPW\bgkpu{ $/9BJQW\afjou{)2;CJQV[`ejou| #,5=DJPUZ_diov~&/7>DJOTY^djqx~|{ywvuttt (07>DI~O|T{Yy_xevltsr}pomkjiiii   "}*z1x8v>tDrIqNoTnZl`jgiogyedba`_^^^  {vr#o+m2k8i>hDfIeOcUa\`c^l\u[YXWVUT T U #%$"yq l h e %c ,a 3_9]?\EZKYQWXV`TiSsQPOMLLLLL$),,*'{"sjd `] Z'X.V5U;SARGPMOUM]LfKpI|HGEDDDDE"*/221.w*n&e!]XUR#P*N1M7K=JCHJGQF ZD cC!nB!z@!?!>!=!!'/4787}4s1i-`(W$Q! N"K" I#'G#-E#3D$:B$@A$G@%O?%W>&a<&k;'w:'8'7'6'6'6'7'7'+39<=<z9p6f3\/S*L(G'E(B(#@(*>(0=)6<)=;*D9*L8+U7+_6,i5,v3,2,1,0,/,0,1,1,08=@BAx?m<c8Y5O1F-A,>-<- :-'8--7.36.:5/B3/J20S10]01h/1t-1,1+1*1)1*1+0,04<AEFFvDjA`>V;M8C4<2 826242$22+131038.4?-4H,5Q+5[*6f(6r'6&6$6#6"6$6%5&58@EIK~KtIgF^DTBJ?@;782707.8!,8(+8/)96(9='9E%:N$:X#;d!;p ;~;;;;::9=DJNP|PrOfL\KSIIF>B2>,= )='>&>%$>,#>3!?; ?C?L@V@b@n@|@@@???>AIOSUzUpUdR[QQOFL:I/F&D "D DD"D)E0E8E@EIFTF_FlFz F E EE D D CGNTXZy[n[cYZXNVAS6P*N LK KKK&K-K5 L= LGLQL\LiLwLKKJJIIMTZ^`wbmab`V^I\/  )4AO^n~}|{}scSB2# +8FVfxwhWF5%  -<L]p{l[J8'!0ASfzo_N<*#5GZoхНеscR@-':Ncx )6AKT\bhmrw{%1<FOW]chmrv| +7AJQX^chlqv| &0;DKRX]bglqv| +4=ELRX\afkpv}%.7?FLQV[`ejpw~(18@FKPUZ_djqy}|{{{ "+29?EJOTY_~e|lzsx|vtsqponnn$,3}9{?yEwJvOtTsZq`ognnlwjhgedccbb {w&t-q3o9n?lDjJiOgUf[dbbjas_~]\[YXXXX{u pli'g.e4c9a?`D^J]P[WY^XfVpT{SRPONNMM "!|sl f b_ ]([.Y4W:U@TER LQ SO [N cL mK yI H F E D D D E !&))'$vne^Y V S"Q)O/N5L;KAIHHOFWEaCkBw@?>=<<<= ',//.|+r'i#`XQ NKI%G+E1D7B>AE@L>U=^<h:t97654456%-2454x1o.e*\&S!KGDB!@(>.<4;;:B8I7 R6 [4!f3!r2!0!/".!-!.!.!/!*169:9v7k4b0X,O(F#@" =";"9"$7"*5#14#83$?2%G0%O/&Y.&d,&p+'~*'('''&&'&(&)&.5;>?~>s<i9_6U2L/C+;(7'4'2'!0''/(..(5,)<+*D**M)+W'+b&+n$,|#,", ,+ +"+#*2:?BD|CqAf>\<S9J6@26.1,.,,,*-%)-+'.2&.:%/B#/K"0U!0`0l1z110000/6>CFHzHpGdC[BQ?H=>935+2 (2&2$2""3)!30474@4I5S5^5j5x5555444;BHKMxMnLbJYHPFFC;@0<&9!8889&9-95:=:F:P;\;h ;v ; :::9 9 9@GMPRwSlRaPXOOMCJ7F,C!@? ???#?+?2 @; @D@NAYAfAs@@@?>>=ELRVXuYkX`WWVKS?P3M'KHF F FF G(G0G8GAGKGWGcGqGFEEDCCKRX\}^t_j__^S\FY9W-T"RQ OO OOO%O-O5O?OINTN`NnM}MLKJJIRY^b{erfif[dMb@`3^'\[YXX XWW"W)W2W;VEVQV]UkUzTSRQPPY`eizlqmdlUjGh9g,edcbbaaa``%`-`7_A_M_Y^g]v\[ZYXWagmpysls]rNp?o1n#mmlllkk kjj j(j2i<iHhUgcgrfdcba`iouxsydyUxEw6v'vv vvvvuuu uuu"t+t6sBsPr^qnpomlkjrx}zj[K;+  $/;I~X}h|y{yxwv{p`O?/ &2@P`sueTC2! (6FXj~yiXG5# +;M`u|m\K8& /ATiəȲp`O=* !4H]s &2>HPW^dinrw|!-8BKRY_dimrw} '3<EMTY_chmrw}",6?GNTY^cglqw~'09AHNSX]afkqx !*2:AGMRW[`ekry$,4;AGLQUZ`elt|~|zxwuutt&-5;@F~K|P{UyZw`vgtnrwpnlkjihgg !|(y.w5u;s@qEpJnOmUk[ibgifrd}b`_^]\\\ yuq"n(k/i5g:f?dEcJaP_V^]\eZnXyWUTSRQQQ }uo jgc#a)^/]5[:Y@XEVKURSYQaOkNuLKJHGGGGwn fa ]ZW#T*S0Q5O;NALGJNIUG^EhDsBA@>====$&&${!ri`Y S PMK$I*G 0F 6D <B CA J? R> [< e: q9 ~7 6 5 4 3 45 %*,,+w(m$d \SLGDB@&>,=2;8:?8G7O5X4c2o1|/.-+,--#*/22~1t.j+a'X#OG@ =:8"7(5/452<1D/L.V-a+m*z('%$$%&(/478|7q4g1^-T*K%B!:631/%.+,2+9*A(J' T& _$!k"!x!!!!!  ,38;<z<o9e6[3R0H,?(6$0" -!*!(!!'"(&#/$#7#$?"$H %R%]&i&v&&&&%%%07<@AxAn?c<Y9P7G3=04,+'&'$'"' '&(-)4)<*E*O+Z+g+t+++ * **)5<ADFvFlDaAX?N=E:<723'/ - ---#.*.2.:/C/M0X 0e 0r 000//..9@EIKuKjJ_GVFMDDA9>.:#63333 3( 4/ 48 5A5K5V6b6p6554433>EJN}PsPiP^NUMLKAG5D*@>; : :::&;-;5;>=JPVYz\p]g]]\PYCW7T*QOMKK JJJ J(J0J9JCJNI[IhIwHGFEDDPW\`xcodfdXaK_=]0[#YW VTTTSSS$R-R6R@RKQWQePtONMLKJW^cgwjokaiRgDe6d(ba `_^]] ]\\ \([2[<[GZTZaYqXWUTSR_fk~ovqiqZoJnGNU[`einsx~ #.8AIOUZ_dhmrx(2;CIOUY^chmsy "+5<CIOSX]bgls{&.6=CHMRW[afmu~~}||  (/6<BGLQV[a}g{oyxwusrponnn")0}6{<yAxFvKtPsUq[obnilrj|hfecbaaa ~yv#s*p0n6m;k@jEhJfPeVc]ae_m]x\ZYWVVUUys okh$e*c0a6`;^@\E[KYQWXV`TiRsPOMLKJJJ  xpjea][%X*W0U6S;R@PFNMMTK\IeGpF|DCBA@@@ {ri a\XTQN%L+K1I6G<FBDIBPAY?b=m<y:987666!##!vmd\T N KGE C&A,?1>7<>:E9M7V5`4k2x1/.-,,,#')*}(r%i"`WOG A >< : !8 '6 -5 33 :1 A0 J. S, ^+i)v'&$#"#$!(-/0z.p,f(]%T KC;6 31/#.),0+7)>(G&Q$[#g!u&-145x4m1c.Z+Q'H#?70,*(&&%,#4"< DNYes*169:v9k7a4X1N.E*<&4"+% " #*19BL W c q   .5:=~>t>j<_9V7M4D1;.2*(% " !!" "'#/#7$@$J %U %a &n&~&&%$$#3:?B}CrChB^?T=K;C8:501%-)' '( (% ), )4*>*H+S+_+l+{++*))(8>CF{HqIgG\ESDKBB?7<,7!40 . ../#/*020;0E1P1]1j1y00/..-=CHLyNpNfM[LSJJI?E3A'>;85 566!6(60797C7N7Z7h7v655432BINQxSoTeT[SSQFN:K-H!EB @>>>==&=.>7>A>L>X=e=t<;::98HOTWvZm[dZ[ZNWAT4Q'NL JHGF FFE#E+E4E>EIEUDbDqCBA@?>OUZ~^u`mbdbV_H]:Z-X VTRQPP ONNN(N1M;MFMRL`LnKJHGFEV\a|ethli_gOeAc3a%_^\[ZZYX XWW#W,W7VBVOU\TkS|RQONM^di{mtognWmHk8i*hg feddccbbbaa'`2`=_J_X^g]x\ZXWVflqztnu_tOs>r/q poooonnmmmlll!k,k8jEiSibhsfecbaouyuzezUzDy4y#xxxxyyyyxxxxxxw$w0v>uMt]snrqonly~zkZI8''5EUgz}|{p_N<* +;L_stdS@. 0BUiwhWE2#5I_uk[I6" )=Rhۙٲ+6?HOV\afjoty %0:CJQV\`ejntz*4=DKQV[_dint{ #.7>EKPUZ^chnu|'08?EJOTX]bhnv !*18>DIMRW\bhpy~|zxwvvv#+28=BG~L|Q{Vy\wcujssq}omljihhh |$y+w2u7s<rApFnKmQkVi]hefmdwb`^]\[[[}xspm%j+h1g7e;dAbF`K_Q]X[`YiWsUTRQPOOOzsnieb _&],[1Y6X;V@UFSLQSO[MdLnJzHGFEDDD  {ske` [XU R&P,O1M6K<JAHHFODWC`Ak?w><;:999 vm e]WR NKH!F'E,C1A7@=>D<K:T9]7h5t42100//}ICC_PROFILE {rh`W PJF B?=!;'9-83694@2H1P/Z-e,r*)'&&%% %''x%n#e\SKC =9642#0)//-5+<)E(N&X$c"p!&*,-v,l)b&Y"PG?70 - + ) ' $% +$ 1" 9 B KVbo~ $+/2~2t1j/`,V)M%D!<3,% "  '.6?IT`m |   (/36|7r7h5^2T.K+B(:$1 (  $+4= G R ^ky-38;z<p<f:\7R5J2A/8+0('$  " )1: D O![!i!w! 18<@yAoAe?[=Q;I9@683./#+& #"## $'$0%8&B&M&Y'f'u&&%$##6<ADwFnFdEYCQBH@@=5:*51.*****&+.+6,@,K,W,d,s,+*)(';AFIvKlLcKYJPIHG=C0?%;8 522 111$1,242>2I2U2b2q110/.-@GL~OtQkRbRXPPPDL7I+EB?<:: 999!9)929<9F9S9`8n876432FMR|UsXkYbXYXLU>R1O$LI GDCB BAAA&A/A9AD@P@]?l>|=<;:9MSXz\r^j`b`S]EZ8X*USQOMLLK JJI#I,I6IAHMHZGiFzEDBA@U[`ycrfjg\eLc>`0^"\ZYXWVUTTSSR'R2R=QIQWPfOvNLJIH]cgxkrmdlUjEh5g'edcba``_^^ ]]]"\-\8[E[SZbYrWVTRQek~oxsls\rLp;o+nm llkkjjiiih hhg&g2f?eNd]cnb`_]\nt~xrybxRwAw0v uuuuuvuuutttt tss+r8qGpWohn{mkihw|x~h~X~F~5~#~~"0?~P}a|uzywv|m]K9'%5GYmqaP=**<OdzueTB. 0DYoiXF3 #7Md{ӓҭ '1;DKRX]afkou{!,6?FLRW\aejou|&08@GLRV[`djov~)2:AFLQUZ_dipx#,4:@EJOTX^cjqz~%-4:?DIMRW]d~k|tz~xvtrqppo &-3}9{>yBxGvLuRsWq^oemnkxigedcbaa~yv s'q-o3m8l=jAhFgLeRcXb``i^s\ZXWVUTT~xr njg!d'c-a2_7^<\AZFYMWSU[SdQnOzMLJJIHH}unhd _\Y!W'U,T1R7P<OAMHKOIWG_EjCuBA?>>== vnf`ZVROL"J'I,G2E7D=BC@J>R<\;f9r7654323{qh `XRMIFB@"?'=-;2988?6F4O2X0c/o-},+*)((wmd[SKEA =:75#3(2.04.;,C+L)U'`%m${"! "$~%t#j aXOG ?95 1.,*$(*'0%8#@!IS^ky$(*|*r)h'^$U LC;3 ,( %#! &-4=FQ\ix   ")-/z0p/f-\*S&J"A80(!     " ) 1 : C NZgv '-14x5n4d2Z0Q,H)?&7".&   &.7ALXes+168v:m9c8Y5O3G0>-6*.&%" $-5?JVcr/6:=u?k>b=X;O9F7>461-.")$  # + 3!=!H"T"a"p!! 4;?}BtDjDaCWAN@F>>;48(3/+'& %%&!&)'1';'F'R'_'n'~&%$#"9@D|GrIiJ`IVGNFFE;A.="95 2/. ----'-/-9.D.P-]-k-|,+*)'?EJzMqOhP_PVNONBJ5F(C?<9765 444$4-474A4M4[4i3z21/.-EKPySpVhW_WWVJS =<t-ss rrrrrrqqqpppp oo&n3mBlRkcjvhgedv{u|f|U|C{1{{ {|||}}}}}}}}}}} ||*{9zJy\xovusrzkZH6# 0ATh}~o_M:'%6J_uscQ?++?TjgVC02H_vΎͨ  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"$%&()*+-./02346789;<=>@ABDEFGIJKMNOPRSTUWXY[\]^`abcefgijklnopqstuwxyz|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~mft1!  !"#$%&'()*+,-./01234566789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~  !""#$$%&&'())*+,--./01223456789:;<=>?@BCDEFHIJLMOPRSUWXZ\^`bdfhjmoqtvy|~⽬wf㨅yѭ֬ЕjNje7 PAEr&C[TE?R{vضșoMvIpo6Q?>z6n6;SBh!GZ*%3OmȡU, ה[%xNZXB+3b,)&S Y% ŐmYSUbtƤd<ƊS t5bz2KC:w -?#_ n'v;xic`bitŵ۰eC$?ȏ\. e)[ql^5Nr@04*^  m^>'ܾŤhKݧxO*Xf.7IJh,s{d6WLgA6,#ZVh^OD:1+(&&*09E¦֫dE' {FFb5DA+n-AymbY,QfKIJpwvsrpooopsw}ӳz_D'{ޥtI%KV/*@iR6>-?teɯ繒oP3|C;a!:(QtgY)LS?3*"_R"5BKRX]bfkpw~Ӵ{_C&V/ \](*3sU;%=e]?{vkᵏmM0-X"J'T(+p -xQiwYK<&/`"3 M5B .<::;>BJWi[8)^@h3e&d "C-D]x;FVfvgQ@3)! 6q4_$Lx2}iz>,Ea~'+;L]p㜥unhc_[XVUUW\do~+ M|mYDFk2F v-EC ;Yx# .@TivuvbULD=83/,)'&'+2>Mbye 9c9_"'EaQ!>]( /D[vfTgzԫ|yxyz~H8.&   %;WV2Y="Egg *Jl7(>XtkՌE9ݜBm0e͐r-·4e*{)bjJ-; )# 푖J.լh_XUVpd3E3Yax L gI3e7 ͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb&{b&Wf]vb܆*܆*܆*܆*܆*k/vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]v9QT: ]-]Wf]vlUٱWf]v=#w v[ d []yYo5M0s5=/M͗g6ᔩZ)Jg9׫n6ru*tKYM_3iEXvJ[mFwFKrGwQG MM(>Y3;iq.l.P Ǿk>O_)M9""EּEپ?""1.77 )*@E®͊-z͊6*ثb͊6*ثb͊6*ثPu*8PIB6-o'(2$(؊ٽ' dmxKO2VNrf"YaƗy*XO/2"i3E!-ܬhIf0 Avt K"FVKߗXeNk2Dԇ}Qiߖxbi..g`"9a3^Wc򝥥ϘDCIl)>9vڃ34#cM$Sp;tU mƊSf "h2 ;izΗs"Iqf'1n,9X "aNXf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWc[*n*8b͊6*ثb͊6*ث׮*~*ثb͊6*ثb͊6*ثb͊BHT 7vv#M6i:SFMJ$v4cIN hgo!rtAEeRG98}D͇qH5]꟔t/G*{otͱIӋo,yvK_EbHr񋌭 %J(эG,"?{ikk4PsDdc3;PvfT<{gFմ]'\BkӚ..ݝiȽ֚eSс<4\[=%52CYyYJ}pg /c;3sC?sqK/3;moTdBT3~Y0mo 7wHv[~ aHSqI.ϗk_QӭѤcEM+ZHÎSp_a ԺF~U\>o[[&giPvQښ!X5{/.%RjsDcyN^ev®͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثbƷlUUټqWf]vlUثb͊6*ث׮*~*ثb͊6*ثb͊6*ثT$v3JG%9TvO4}W2Sƹ; TwᲴ|4Tc{F#FFyg(nEkZMs[v9q#kZ]K./cSԠ k`dX`+6fqkgxR'=1͏'y"G- kzgU~E֛ivKPsbZE}g#(b71!KP鷱4˖TA'Ą^dG"<kT x+g*All]7Oqsӷͻ6Ff*YNO[1FYq`iu]YqKe5w\ aA-`כjj-Ҩ"݅rߕ5VAc)<^BcD& Uك!v=@ݜ:ޥq}+t6|~D\iˊD.͊6*+ HoҸ9 evM4/I-s$b7vOtU@)f wF6vv{/h'WuP = .s7ݾ Vs5 J݅w0)y]Fe!,H淛$r-cũ=+yS2^:g EQG.[[G|[*#i@ؖ"udB#wߖ7&hȐW N9,/ 9mU"W6N߄H4,Cu܆xߕ瓧se3fn ٳ{70#BCt9q͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثv7voUٱWf]vثb͊6*ث׮*~*ثb͊6*ثb͊,$Wv ++0g1^t x|W҇)0gnI69Ymb8<0$3{r 0HX [6 vH-Vޟ1$wf+5L rYD׆ Y:hr̚'tf$X`@frTght9C/ yee" :7w6tƂ;~Mgڭ7!<#nΥױ ''d sq u)T4n"TS+Q㕘2`v=:8>0:dLA^ zwḲ!nH&f NI*90u9X)vPHl5Z+I%eW,ɋaދ6?BB:$ri-ۉ49f&3tCXG5|2sE~^?x>occw}#X]=; h3z6$vKVhD]>hjֱu^]HM#X=(b!T##ewL-‡f]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlU튻7*ثb͊?ثb͊6*ث׮*~*ثb͊6*ثa1!]6*ثd ENѲ7Xukvd2vIm{Ɛ\GQ%S"l(0x$bk%C-L\0:һ+X$hi_h\k`~q鉔~%2d+Uv+[&t!Qf$r3"8G ^iZ ] " cx;barV=qAḌ}m(x9 8`՛&"N׾I͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثbpvqˮ\b۹\|C^Tt9O ݉E@ڸ62Ė¹?#.'4KHᒎZBԇS]Wv{Aj;y;` *|ynꧩ k"aϚ:q3H[YĖ9똅@lHMD[cYٺrJe1We͊*v^*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊ϒAvpUk> -v$1vĞF`'gb[X;*Wf]vlUٱWf]vlUٱvaLU";wsLO viXv8F<&[nY?YVE@e=r"doYK{v26>1mQaFI͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*kv]]vlUٱWf]ثb͊6*ثv-sjv[@re@awe'+c@he#>h7Aojs :CFX&f7݅n!yC-<8쎥Ċh=)LȑA3,{8cga CƬjE79i,i)|-hCiq\r3uXAϚ$ c]e4100ڽ0xe](,}%OɖiG\n?Ncg0<&cPڋNdmeaKb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثv7voUٱWf]vثb͊6*ث*2Q#sd)yYAvG~9Kkt6)E`<46Gb1J5YvOX֡Ckl={B.[%SCZO֯m'XXxm~8!j%RWv#ٴ/`bc*٘n2" O}eqb7vH?Ұ  ٜe*?)#oz6$mss"\cJ'>|[?/8 B*@-Hh9҇F32;#FuaB3hqƐFHӲ!ٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vjWv] M\8WTx`WTf]QuFlUWTf]QuFlUWTf]QuF_Whv$lk…4j7q//NQI*(z\q+ ʌ6q\nQW,GR3k ֑)Y ? ·OŃaK\ITdm6 ]w~h'Ը7~#sFK@5=6ŷ#Q9 |,s.\yE1zGZ2PLIΔI gWi#{9v4c!V6q2y:̪t^0zaQqXqi7SR.n-b./jm;۱gic2H]Mu\r8]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlU4I @OzqqQ<4~EmF_™ȖeT~{kٸcT;.=Uw\ 9 fK(Kav:|Sc"[#<2y|Ÿo[ADw-|t/ws7{YD???⽎x[_@ڸGyM[ip5~;;/?-fޱ}sK/(s;+"^{Yl0#U4i>Sa#~ORhq$WӰ~vtr0]0Sl5)~\4\s;DX6WF.3'Q4F x.W Sn@Jk7]BF$*F_riq8O/ oΏCZNhb^-ⲸcDYqF`mEiPtY$[[/H=n~h{sha=EeXikck* <>.yqHzFԡ$ f7|ݯ[[d &mlNv;=fA`C<H^IW.YQ\NQjWdZ7i BIM{~ٽVP6vBxxϐ?ֵ;X .iEoamwζ)"ؚW6G'H=R' (sW[UX=ggw2{=?2 [<8Bkm{Ae&h. 6.Smjiu2/lhC~9̮tۋrC!ew_ vKl,*iO|!lKߕߑma ng[">ymU,YcWm$,-ឆ>oĎ *(3'.",Qn :Jw>*g:%m+[)g,I )>![oTc) A-L>qc䟁.}e4Z6$U,Wf ( =.!P M`Y# UAf'N[r`vx^vZ{[5>g=R;C5w:zo6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb#*CDccZLy{:$\Mq\}ˋO7j NTS>gn vlUٱWf]vlUٱWf]vlUٱWf];<9Me- 3 { _oq'旇|8WJgIQڿ#>uo4 c=z<$k;>9EV<=3OSgR{ ng5G#ħg-#g:3:c+m2kۧ*X׿x׼g{{h_a~,vDC:qb;o(qjr92JZ;H̬6$tK<;Z\?UMO=sZ}1֟] A:<qbӥ󾐵zBdgPӼ&S>Nn"_Pڕ[vfIC#^Iϖr'1@?w;|OUtBWU֭mv14<9%;{;[)qLsߛG3_*8nڄHOj~rݣ,,^>YkGԼDaRabLm-5is$z$刃POv~}!aOqiz.Lջ@N1sΗvڹWSbnX7RV'nWHءثb͊6*ثNWVy W@$ҔGf9OʟY-23֮i=~^RGyó{ƣ hRi/o_(A]XvѰ܀+Vs{/R|3/k5dGw֐|+Z+"0[hQ \1b Skde$Oy?r=!|ߦռ= zkm"Z"ధ\vix0LaW<;8.qN-r wki'u6Htս^vXE{st W`??I"W}/H"/iQ%#~z~Zp㯤%R~d=Nݽu~iNZ,v֕+mJm/^ȟ`Mse0g& k='QQɞwBizܧoIdhrIڽ|*j)ivT}4=t;=ZXiQs AvZ%,GquXާ dxp gK6v3>5L.|g9>R`4{`W pV>ЏpnkgƃqZ9%Oϗt{O1hfTua7UͦX=ۺN'$:ck n?#6kf*E=ڳ=B 7L͊vlUٱWf]nثx͊6*ثثb͊6*ثv>ǒ@vitXadMӡ 1, ovu(kZ֗sf_,4=>=> IHx/9L%1<Q3f턄;9^4o,]p~77}6S՛' ieVW_|H`*d1Ο@Ut> 09eG5CmM>=+Mn-u2ZGJdYĚ% >t򮞵aV51fN9QPd'TӀk3ZCn fN2=U>1?[켷}VnQHU$ ;-Lsyޜ}Fpl\|gb$\-:{UٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]v+yh>NQW$,j3]=ЏQw=/>vnp#Y<ߜ^SIjIHy_jtJ[17\ᵾ~ò67>.Nr|b~jc2N[d4KK:*WBPzE|B?¿UMJ4FD;ljAw98Gx &3Ҙ䥨oV #{FzSȿriց};GZ79q`{"xHl2<(Ln/-tf=3j֗YQǤWi[IfuxGϙޅ>4WB)6-3/R6W@S|AV`0w͊vlUٱWfqWajpXZwsp!%.ǠodM cd9rGMQcUP6毖te> ȿĽK3Mr)uo,LYȜڻ񒝽λ_rhɔ7CGtcP:t2_<ḥL~s羫\XL᐀g>7}.18nJ :u(5͊vlUٱWc[*n*8b͊6*ثb͊6*ث*H>R>9m0JtId%P|M&ݝ_͚wu#|`ŏ|zM7◅-vv{ɧQz~cz\y5dzrS)k[ X"0,~V<(wW~vz0G㙸C%˸"?03[h*{f~i1 f3))Zz-vWUيS֌U˶d`j/綾]HKH#V .^9g 7yjy^w&< <K<}'ڹ` rJثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ث{qT(LEBs8GizCZq02@Vg/KRLsv1#i3dC%>8k~rBb8H*w:À6BD?)~c\yC6X[A]ٜTFn= *BW5#Wp{_372Yn~r__}~9R/-'숆AZOJsv|Jyp+]v9>gm"&wM/a0Շ?;ȯ(?e̯4 wm_ĸmgzɦ1%0rҮ"~¢>C(:1˰!8_Xe ƾq Q9Co?6~̪ΪTag9"7I>Yl=ցYqK :ӂ蹨iV#咝3s?]!'+zW.FA˧1yŞ*u|9"Z{9^ax|ŝ.{}6~cGޥͣFzuϜ-#5h/fXz^̽skpcŎ_ǻgwe09ؽ˾oмmƙɭTfSJ4t,6*mKM"֛R?/̜S;"A܉chNX)YbpUaPA9^H nŒp'jRĒ+uaBT}rqz;=R:Tj:rc(}۝.o5GTeGydu܁\ѥ$VZ4ɍžT.kv:8-$i_֞pQj~p^ GPrjo|>ljr~/o>ԔRasѝɫP~Չ]2wQփmə/|b+}uyN0!QMi.baⱭM€(6t:1W=YUcDm۸)# w)ۭXqrºw|1ӘVk,U=u$,n?][Ǫ2s1/s|׬*Htv7h*{aiwo}m ݤ= !* 3N S3bD[\EuWȲ*GSPAA-gsB6qs„r&2 dLDă{!a[yKU;gȯʏXO.+OFF *~φyov?UۿgOh?/]Bs)Ϛ-qcs`st=b-FX޸MY5͊vlU튻7*ثb͊?ثb͊6*ث{ae G7d1;mLSA 0SR1J]b0(F>?g?v7I"w"pxm7T2[v /C;|& hf X[nHiUO`<,zy?c1aaV;p<v6Fd7BӮTEۿ/:,Vv-,:1#dˋpCtݡDL^o%-4hr= 9b$tބwK2yMH(vk]}/ڎ(g{_7KcGk6  Nk>w` <#9e}֫KkZ'ywxQp~et?&oEYl,zZ}{>g8\KF2x|?ݏd<)Pj3tM(PC|{Wr]Qt#GFJ3Ha ~dm7t<@3y6gQ)V"KgR?YrGf_^QX|O{>PߚrQ"^o5lUo.PT&ݾ}bGy>cg/}O2ab}}k$3dh贸c@E_ZZkBOZZfmɩ%d~`oOID,>)hCVyr ot/[iF S<jWZ],CӝFp+Ү4CNб?h{x& q,3 xSP HX3(GIcI$20Ap-gsBS„Pyq$Leȷi9cDBZA{m=bXgB!Aϊ_ߑRyW-iF\iI)<{8s'?C a"~A'gnɓM*OZE8=VϠ价8MbX*@wP!BiAf? |[g9]F5V-Lv.A~wo.Yv~UГ[F_ܩy;.Hq̋#2VEcJn9h;_#K}O,|8͟ߙcKGD|3DWc #ĻRI9fd~#"0Dl)?-wfSK<,ےIM5ivi $7F`#UnFo6*ثb͊6*JCu (ErIk|D(F6+DV%R|ǖ=F#p$9=ےX|wb#"Rеͥ]?)HOϨ* AGB3Љ~eb=M@=As`"[{A<˥^躽]FTP^1X1灌ŹY;?QN U-5k++ȄΥJb3wolfMDC<>Z,'짴{Hu52DOFxtaM`{ `GCZثbƷlUUټqWf]vlUثb͊6*ثXӐ8pj ;Jn èNߴ~XaL˱[bĚ݇69AK+SNƽѮv-.oK mZKhOxH]0|۷/;<Z'mGf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWa ZɱOrG9[)=Ԍ6SI~Z"V =f P.͏wڜ'jj$?U)ahԈ\t"F|vf1byldk{ DZ4?i7|+3Ebk3殨y]9kԾ,c T6*ثb͊6*ثbb`Q#FзL]_/my E VRBM 2nd7ϰ=  (쏗u]f8 ~7T߫k/-Ik,N; $WF✱QXIcIQ$OϚZ7~gBH;eXy)z{Qe̎?bFt$Wv5ΝvI"xUq}85j (sxao1iHfFe|FHv=!8yv~bXjrs֮ؕR; 9RƆ?Ds/ߵ1NΖRy-< tzðϹneXZit+mecm EpC#ZDye,Ɗ(( hiPy sGFcF :vѴƀ*3 ?7UИ4Ӟ9ۺ 'nٰRB.7?1.Wm&So۷E 9Q[k2Ĭ`Mu=)v{z9o!,aj6yZnxr".ȝtZ-$47 .^25@"ْZf]vlUٱWf]vlUٱVprEiB`A\<1/1hpj6 >t,-jt;KjRs=o>a >CY~'X o޲ٚ3~^n[o'f.=oeCN.ZoqJ:}7mvlu<{o`}}C矘W_1$ OL}=ׯ%*}|Nw FITЌDN<-zջRRa@k[n?9a= rms}t-Izm--mmX <3ԡ9\Fs6I **'CX]8HGsҊ+ϔbdz7h4Y5xqͶv<3tE@ϏߙƥsS+0k4P3;CW=^id'nܽظ{CO P._(X_~o<׬3\IrMH * ^[j,]+hpPɫ3Ao6*ثb͊6*ثbZ5޽_~JXhՑЂ AG$,~_Qn(9Tq8懓bu H 5i'=/. }Q~T5+S(%E&|@^G+gg%?-"[5} šig3'g~cQ{K.!]=&ڎńdZ#znяv|ց&{:e )Ќ[~PיRs"48AWf]nثx͊6*ثثb͊6*ث׮*~*ثbRC t]ޙIma8)Mu|cEKsZxkno)jc ƻ-WbxٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlU(| shD~nJVcÎG'c~c Zq?OX[?-hK-lǩ5fÃG~<6,Y5P 5 ~:?pˤhanL3~<%^}nN=Dϛgb顦|%ffۯjSo%Υ31du3?<>kNLsb͊6*ثb͊6*ثK囧UbX~G5b4XU)S?Dߘ#~Kgk$¤P-k]tZGC gu1㑌7ky`G֮Yb 5uJ&z=y~_eCԿ\hM1)~W77:rf$u.[fbƧsnUZƣoa<ƪY؀:rnnX!w'y*|u6V^/TfWOTSi1Gཱི>VZc7%?}9Q4#}7]1|9fѼtIjcYƀ^k͒ҧ<7댦W䗓<4,k,j}qm%@(ıTFlUٱWf]vlUٱWf]vlU`!Qu ̝K>o nEj ",9x3'E0uWG=>Hؐ5^U:}>bΩ-jwQy{YlT"7uF{0ˌLuĝSH\坽f2(zt#zcL*x9`g#Yzqr|934o$5's懘u6,i瞀'wL(<1EZ}]˻$(#@PUW6*ثb͊6*ثb͊6*r1F : *$k"»g?6eѵ)eӧ[j!4IOWf~./+`:mDc s[k[yFW=oA0$9[O<0AzU<1JrƵld8)GSCAe J20mNd$l,Uޠ9Kx<-z($qn@ۄ?ښOj}ڝ7UMY|gaK-!L-f)H0^UX 6*͊ݱWcqWf]vlUٱWgثb͊6*ث׮*~*ثb͊E)B9Y =n#?zdiv#rivlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]#+=yfu ڝȾ ȹ>dc!'bc E u9s!1H4Afj#+YH'OcFt )`mbuu)ܕXbG]uS#XMf(w}7n̄Ae3sPnEK#zNx%?#>4?L5rsSS98Y>M%sb͊6*ثb͊6*ثh&hdVSOP0є;O/LaM#!Za3 aKMJB̄~o1˨rN\oMHtvvBC~gS<ݫyF%!d2Ooh]uovCm ,qE`x@932SeP W$v|}5/ёH8TcVUO{$?!}*2^$Eki <5줱#sCҒOJ(.*ثb͊6*ثb͊6*ثb͊:m[#)%lŚZȄVku?3Ϳm;K^W?fj4?eu6#|g?%F_yBѤFOtcݞεlR7]bl$~s/]M#c<~}<k_ FA$?_K_̠S9OrއD]iժJ6_IiWҼQԹisqz/j@<o$VB>c,6~<>ö~UB( :6Ѫo"IߟT/LvL0+G姛bIN@]ŞO=?,v,$~η-έJiP sךoRO!8+jJEjb͊6*ثb͊6*ثb͊6*:/Z6VB0EjߘJb~7Y=K &B}~g5>1r!R'ݴZH?yb 5鞗6+Gg4<.3(<\ 9{a1:~mqcˡ==AG&W<昜$WCw@ Ԛgş3؛[j)ל[^ME'~#"ZٮlU튻7*ثb͊?ثb͊6*ث׮*~*ثb͊7z*UٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUݿ$6lڴ Zj3ũ<9|.JXOg\Z?IF@g\[! yG7y쥠fiKM3 ǻ6^DUʧSOp= gK{XCȋ`,X sˏ`&%⪹Wf]vlUٱWf]vlUٱWfŠzI늮<3.**O}_t~]G-י01Aܗ;/dSS4vLJ?ꗸ1QF{y,?QX~pO *~fQf ǢOѾ|k|':ER|gOU^o~h+1@>{/Z~*;(F95iLrjf#}١"@Nb͊6*ثb͊6*ثb͊6*4 ֔VHӸϢr<omBh9Ĺ3F}":B;YӦ.m[b9Tڻi{osgk4{{ ojfπzwJ8'qXo&iV՟L~L];gU[;Yxj}';dd~ogjx:h򏨽IyɨfF}!">V秡 ^eIg)K9:>.x@2PtFYmoOχcUn%$js3g~,4Lx1|Co>:)&gI;}[MkemϽ4Ȅv(ڊ6gvlUٱWf]vlUٱWf]vlUٱWb+B9>Ͻ攣Nm~T?Yӭ~3\܇Anثx͊6*ثثb͊6*ث׮*~*ثb͊6*ثPb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb\ɪ0Lfױ!Ŭx j|._6'0}Z:~]F'2AE|Vִ0+^۴P4s O. Bz/eu4=>sP_̽+W<$nbI >-s~J~aOy5ϕ*Mg&>uZdVl5YI{NbZѮ-^ +9RWn;+vR:\ZK~@b v!@pol&TV+Spv#YFG TJ`8JiDԣ\تثb͊6*ثb͊6*ثhiT v J)/DLsk3w+ګqR>H󟔿൮l̈ F)1'Ɔ=we9lofj yp'\fCK5ҵ+VS>mOSXVBeK>1>#Iﮮ%Ż gߑ 6 7Cp}nƀU_6*ثb͊6*ثb͊6*ثbqZ'DW#y?&Oko)& l#'yOmQ>xb7`Ut4ROJ(H&lg6] ./u{oO-e#*{s[d=g˧kY}{fGZ4wMg^ҽz3g_9""_KSNA>' SEq]nثx͊6*ثثb͊6*ث׮*~*ثb͊6*ثyly&kQgpzQIj5aq;9e6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb7O}}vUmFv*-ź~t~a5^o{[,a] oy*K$c]U)",z!0i;PŒocx(鷼 Jݗ=pw?iO@GKn4m65fP<˯0qw{T1Klf|8AKUZ|jbjAdjq8>ehVF?-|kgHӮ$4ST&\90ƋZMf\2EZ/Wмa$Oln #ʜe6ڕ‚BLUJ6*6*ثb͊6*ثvu~!ZAXӳNU"?'?/죅 u 랻t3fmMTI(s/s_׊Eq_.?@?/gO½ftZscբZ(̧XnKf^ۧzN|;βߝ$#mKr0GK)p+?ˋYooPzWK$$mŶnBhLJG~l6,ɻO@v%#_l?̇^?[4A5})^֗sFظ'ytf9CNoEiwVoM8|^*6*ثb͊6*ثb͊6*ثb͊:~`4v̪zWv\9b|ÁڸFm&XFa~jN o +*_~m#Psٱ? jQ?{(ϊqlT?M9;fOL9ӧ~p뭿i^x}>s/ȹ[WOS#T_U1v7voUٱWf]vثb͊6*ث׮*~*ثb\U9 CoLӗaF7vyEn&OEqa\彦-4jc4cČgv.,h;:\<aMٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWc<գ/%wRZMX}ٝgӗjà,=vE@>g>硿3Lثb͊] O'dGC{2zVGzD}G-o8(]yX_VQ?/'kַAmS5)7+v>sZea;8Mֽ5#<=4KATW>i~f9y5-&)xxg!cY"}_('Ro1Z\W-^6T>Z]͡!45@u[R$B1T0jSp{bb͊6*ثDd_1"g<_h?exT? Aqd2B; ]+R5k(U%NQ9GvTWR&_1#ˡkƼeE%| %qŒip_)g1g毪Lks'Y:Ѥx՘eY5 i:$:]Jz3Q7s#g`X~ʱnsK[ݾ.;xtM67v_0_cs fGYôk8-G),m)2ef_.[մ2w1Ha\ϟ)=Îؗ+iY YAGgǥzY ̳jثb͊ tf+}B-y$Ƴ$??1cן3_d٨v t+[?Dgb#~?m_/Yc̔/O3d{f2{؏\/uiJŧiwQGJiI*DZ9{1 ;]ZlR8 9(N8);xkyi{Ogu2hh}>\21:`Ux&daUd`pFX3b͊6*ث`Wf®:ks7W(Rky:*ˊ9"c!`]V].A)yTC6y(I][Vx0#XBZ[J(L%٪N}m7O&20 {N#p~ւ3}lASPȤ2yh s T=Y<3Ev&o[}ӏ|du-부c2Jퟟ{QBi3H/ݑ#.BӅ vvB$gd1WcB;bWf]vlUٱWf]vlUٱWf]vlU2-^eqy%zUdGqaSc)cAՈ^AmocoӥV0{>#? YHd~J§| jѻ[?!yW$2:ն̜ILsvޚ#d ˿9oC9aJW\gˎWy֟:cqe^[[A˝*kyo$3J@%C,@ut;% #ͶӎqwEL!p5>13y`ժ`>甿2<٧H5X)CO&\A{K{ZkZ:mֵZO ~Y֖֤֠Ҳ۸ai,{K)QaٰO1VTPh7!ONz@wR^ms>T_5eɈw{_ɞcoFQ{k76Ew 9āK:ncL3b͊6* =Π/?.<eҡQP2] [uQOiud·X)6kURQӭ% V5= 80B=WsܹY0C Y"̷ZYѪ&wJHq?Ag?gmNnz5#v: 5ygW\gq~xG}I6\̟P֠ON;2#;Ъ?=A wiGGY/tyƙg(A |f:$):6cGxe PªU9GrCDmF8L, +]~k؞8u>9 0 PEveBbC~{q*ҟ`# 2a5L7FL3b͊6*ثb͊6*ثb͊6*ث~MXK6kPn5[di/Nj,Guݯb11Ko~܊3zVVHU@d{eOSD S- CL?"$ s^gioh1Bq?Z4:zOU|ϽW;gOX4ZeJ"j|NZR[ƷlUUټqWf]vlUثb͊6*ثbdRt57?9c㟹ǡ}Txg)Ok8,BE"X2"Dn@9 ;*KZ'国k824dƸʯ4˫Za9ah+3uA 6h}k/7='2=LU>OVv}jjM:1Ŵg/MӭL"dZ5<Jx<@|=1哀&qjQVvڙ)O$+?ŞuV߉fie;zAT.Yt gΌk`Wf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]hz<Ӄ){Xd?ptZ'ᕩm,Ь)jdi3=)_NS>}fEˣ)`xw If#(}!Sy˒G]vi!ڶӹٛ]NcP|l"<(Hh:FTvk򧘢`iwBn>uXsl{Z$qß |֡m`7Az-$u}7UӵHȯ&& ?,4[WfEd )9kjpD j"Y@ 3bRx-Zo>/')t+@g)4={ qvy] ٠}ۙӾ@sb])[O4[#zՉ ӟNY;>g?GFvy .,ߘmZJ(Ny1{55Ӡ -&(!Y[Ȣ5P[CZPIn]ԯKm:k˗J) }9Hԥɢi}+{Zn5Z!IGn*`#;ΛYycKn~ß/m2rȎ!ߕZjwGeGSHC l$YVӭg_R) 7͗i:lFCh- rGFFs3Lm ,ȗ*|(OvHW{W3][3FCͱ(y>Tiqž靾p@upKےXP6f8oL WGm=3*.*1Da8M^1k)x _VnwvVy >[t3r7ޟALX7KZ~ky@i𨠮q^j*36mQAWƢnnx"b|⏜52oӜoџF葯R?k <'[㞟K][~_rzoInZk3-<g3|C槕VKӥ~k҆X 7 vˢɥ@O5mD|-h) 3we(lh7ua ʪ)LcvlUٱWf]vlUٱWf]vlUٱWe\ ]1ľcæדP!Znr:C׍b(1mE~[+soSnM>q~06F crAKxWr͆#o$дՙ?W:Z'a{݉ :9HOa|Q\yC򵼡h&?F|d&X)OdCMt;q<,3b[*n*8b͊6*ثb͊6*ثb/yT֣k4L p4 <451p΋];\?S$~#o8nxnXKbDCqo*Bre-pvrͭBM̒2!.XEf,v&9(u3byE޵@S[aSgY:P3iп--4 YEpuH+],+Dn>$)GaAs8˳~Zy_io\I[SͲ.%ӝ|c'= Hԟ}Ư.~7[EՕtmsEt'=X|ӆzh5V)o6*ثYzfY^\⡕Hˑr4z\ˈԢl!-`1,3I>/Q>M-jLwL} ]l|Fy_mTYy?^{."h!<,ߙnt QgBBNu547V تw2rR9p# /-B&MӥOL=x:vZa쓞;ifT5ߩF5:g>!],A)­u$PJ9M饏#r~ũ qüKIj^3-H_>iynGomn"h淑ԊTc Ѷ2f2Q(!đZց*V#hUE~PUu R7C`e$So_=>r36y4zg,|6M5\nRj"%hx&F/zh;"hώYBndE+ֿ˫8>j:ٸF4pßə=i0=w Ltc>]=ݭTypvvԳ O.eb@vs}{Hnohnԭ-3j58ډm^Ϙzj1ZEaԅ㴄Q=3$:)K9k@N}"yy jߘz.!o&06MY{)C`Q쑀s~0]k\) C_B1;*XDcLǙ|TbI]jY>OO`jefњ+U!qjdO!P\}N?Ud6sM1zǦY}9mŌ>O>ϼa]Ua[${0Fv>j2]m6-\Gh G:x%WsڣL6)vrΟ&Co :yMsb@悴1~kM(q=OG_jym$'!=;",A}^@Xثb͊6*ثb͊6*ثbǠG5T31.aI#՝z2/)>-9XݒgP;wϩܿ;'؍V\8`Fy(W #7id8 2 4 +{8Ydc@Ew9rC-ke[š.x޷QD']:x7ǝ]j @ϝؚՎx6kgx{v5b㊻6*ثbثb͊6*ثb͊f}1rt#kIvopu{t9c5!r Y~KKȌ`R sӴcn~ 2]h:7djLQu8d"\ѼϥBNXVm`>a >ya\׫xKC #<|*rA(4`kV*;WSN۹Yt˨Z#f N1i`) `~n~ {v$5?HA~(iߕn2zT5X?dn]ih2[ܸu;6q2>-_@4/A6]ΧSFP1Ϫ>nyzϟ5WUKKP~ٝ xw\Cex&g7,k;w${t-{p-v>K=KU\ kJ9QM|zi#sjvx@#pnݾw`L~s/&RG 46ZR>&w.<\JҎY3>RhiF&y6χߛ^ikyvos[l9~J8A4K$kaC$58}m v=^yi;DliBrOc0j͇ih>5-"KIqgE-#M[jVDQ 6qCK=.xgH3k95Y8?1Y"({r]Y]C+OB|˺ֳgnIeՐgKM}2~P3bGNΏąk"Ϙw2#)I) EѺ&L *0ثb͊6*ثb͊6*ثb]O+K;XidXEK34Në8HtS-"gq#ʞ_8^au(D|Di_iϛs]zG(-#>76T<9 ity}Z!Kڮ1xQ.oفs$}y䗝L6):CvG揙ZuW#yK '|}Eg$bw$o@U[6*kv]]vlUٱWf]ثb͊6*ثb͊6*ثچjsӴ7>TPɌ ȉlW󧛆Og -{OmG.OĖL0r Q({<.maG>eC[\C䝞My6vr}FPỉgFΏOXN)<ݜs>ASzl@΋Eq&ū&\F46+bi𰯾gj18gGi<6$k<{\2J|b>c;\qc3,,6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثՙ~ɧSt(E h$WUbH5Ha$L$.'y<&HInCo m2tH<^bIzSŀ랋l D<,@ߜDS?PIČuz^gAF{:^vlUٰREEt}bEap^mi.-|>ikj<ɦ5Ack\5([cY5vs&W7R`Yj3=o5]eKh\A^|? U;T9ЮCծ4+o~N}IA~oznlUG6h&my(V#a`봐)w]5pa;~Z20ʧc_X||ul<1x$r*EpE(T$QUEFzc,I6INqvԵM&QCkkWcGO+j!g.Amvx`.S4?ZK-{Oޏk: =>#$N9r'qé\$-hnc3r~C٬}/mu/ͯ=lUZMV§mOS5ϫɨ]Ū 1z7~Ol@HQ"Y%g@PS ۆMRE^NfV#gڏΕ/Q|;gixߣ=L{W/1}Ԏ~(IϏSkw-/UbJdS<]9#c(i _:~7k%bmG?ڃ>zyR{XAnNwgGNE¬6*ثv7voUٱWf]vثb͊6*ثb͊6*ثE]*V-v̀"f6<02ڛ1DBzgXK) O~F s4MmO%cm6}S[ jvQEˬ(K,#r]fGY,O\h_p}h {8_MqKHej#pFkc{3[%]: Ii;"ϗ4b2'$ف͎2a11/O. ʳnWӐz`kc$WbOa>ԾM*/>b2f.40|\ hd׷垳"3Gٟ~K1C7 _[=gD`D}%܆YmUfMeUfc@7''f^yLY؂\w9< j^p'еc%ȣ=g&Ǽ5d,{K}rYͿ86EE T~;=&C6hCl,UЯ|_/-H͗sw;_iȿھ?"5nrOwc|GDʟTm4Ö2cCgTd|0ӏEnBHR(Գ=M 2iO&)y"]g(wWR9=<9rrѧ|g9QėH[3K'D#8 ǟ?)?0-^U hϤg_](`y..85aJflt%~T`bEy7yy%5hj2j/s]{'R!mnr_+_m5{[G⿑C!^hTf47S^X fI=QYc# \qCs͉3hqA[ν~@qu~_jub[KȡH)>^aL r#!`5a _[=gDe_菳?e,3еzF?菳_fw!>dv6$jZ6 -\QKt̝/lh2Œ2p6דKȧ\\\\0ܬJ\Y-4O&}~ŔGZzF+R@N'<$sv]N"~HauCPfwA9cţ˗ Vޠ W/mEDorTs?q3yq[1y"l! P;n{7Çqf_WV-1P?eQ3 yvl ?yz/4?_OS붎"9:aO(={7?*>ļ.^Ï)ݚr_՟/ͯ,˥wL3P-:RSY^)9Wg_>yRA4 %"fSgg˂c؝0ϧ ט{ѵ/-ۉfSнMF;;#-/":8# ` >M2YKxʧO;2|ޙazM0C6]-n\|'g7$ȸ͊6*W:w宿+Z\̨(%bB~'s5 -k`4#|M;goc@eD.j省ɏzft4x>Ku>M(ij-՘NuYiXbry:Nl%8\LJ&ic 9tK<* H\J2qpC7 }XHl?;?S~_$y>P'JE=k|ԮgUXZ5OcX;r 3L64g>"ͭi!-|i($m惶:}^17GqoO%&Uӈ-Ebl$Q ?3?,(viwjFEhzib~v]f!(%$F^@% GzSA$E;eNS-#X+6*ثb͊6*ث*iWTKYzS;wϙ?6ۦh=Y2~N*Lm2zlyGiK,d8ODI\[[ð9 .qM#ZcBX 4Sv=9-t؆8l}Tyc^O]ݵwr)iec@̜#&S42 X"h!uMRGu+C$*>rC~x.,vqIb"Pi0ۑ-:qaZ-'~tnHK>ZO]L9Цw}Mwt8wŀrj$֯[?Vӑ5f~1 c~.id6W:We`]MUKy~Ue;k:UG(5Oh;K:që9"*^rYtH@IG|5I*}=hdVЌBaxWmK8$Xq#̺mfS9R2svyʿ'o,A&&F8G4^r0#_bW15OZjyG,YZ3}{YyeJ8EgQ _Vu3C8S:5}q?ts󚿑 ?1ӮM0/3!+Oݕ.ǪsCb@1ښs w!9p˒rCG.3Gs]9?ym:`D:.ɇKK;vмjR>GFY2F7' 37ow<H-_\>M hbbU><>j˭ o3yz)͵MR> +fOiFK)ۆ'c[@t}Kwiixm?|<7 HteiOU^|󽭟 68|GB)4?;jZj}baLa;Kp8AXjup6pr~{/$yo d% r`v籝cGzj>L~bCA|àOp}T$:6 淰;GQ<#~IcDg@NUPm}JK:K!EjOY z!6~O ,fY cީ\88MYo5^+ Tx~SڹN4< Ͻ4 1a>?4")&BZy^PdhI/Ak}>Y4iA@@Nbv~ dG ^| Hv~j9/g?.vi),k1z,ZxMF#!rkcSƺڌ_ aݧ ?izn#֓\o?'Mo:i^ّ =+J =_Y۹% 0sfSm˟ȿb&5<,#x9ZWt*iz]@ vZvlD܉ "%v8e"s5}c*雡lM~\~d~ZTVmQĀҵzG vNzTxEPv\|0mFD?Z;yR,tDdP@`saОA$bg.`&%)rg?!C.cauq#jZ8߀c>X攤>'F ;-kϙ<o&jU ;]?leZo>v^ 9RW/)ז4 ~RQcEU*N|ǧŮ\afy$z֞vo\??i󕏔aK8;Uݸ* @'='??]Rm{_jT(]GLfoMH=Ի/qkq;? {]쎫5><љ_6`c@xYq3nlR۲k̝}'_Fw_{QD݊Z{f337> ?DǬz;n_1N9WC+9|__TӢ5<.ň<>o>|}F"1fADj H ]3#FWfPdžAD8Hl3+WJ=kAe~VS VZV_6^I-4슱,ʼn=Ner#fݍ TF\i<)I^N`ZPu]uzGz_fvF= 6[m5=LqQEZ٭Yy+Fv[ in'KkxAi%lr(H)ff<122GVR 4@0h, 5 ʏ). ,v"CbjȖj5'fz|إrRyVKO|ڌ"Z{2#A__pip۳Dq KY֧$͕v*(QWf]8u4*[6FzqYe)٨{19貉q<!K/t-_K.nE}3,F+|tiAϹU򽷖hTXVZni^='70*{O65>]cu'y15w=I΅-p]݈a^2u:i2;?Q'++wZvZ9rjͦM*"~yiݩͻg&~X#6ji _έJ=7O]/IT٤ol=KO-$$=7M>I1ZskfT˩ySGU->R;?!Sx0鯙2!v:N>~~<;uI8Z~x籺|ȿP?5y<ICȁIp?5D7?6A3yS O%v_dCxaysW+X쬭,PZC1B՟ggRd@'s#{]?#ja 6zmPON}Icɞ1Dse$D |/O=i|-ZizdK!;c AL#rA㐠5\N~{yg]Y58%Fg% iʥy{ 쎧5bF$a:OW\G?3̟ݰEvJ.* Ǔu=_ 4z8h3]rd9ٳ>l>s ~[tc"#d z`>/Gh̺̿/u VwY$bC>q1G bd9$dU:dkQt"\\g5$wF~c%2)o2Ms#r'V+I-^S|qLF\/ڢ/|58a A=7JY֔Ϳ^|j_>CD|C B'o2kz|h2ݵ* ZVŃM.&HvٜȈ6)<88-zF4{ȯuZ&B܂*M3g~P&%)nAT~٣""*1 rOg1ù{z5u_k7iVZ"HVvTga.Hm> yYj5oq@U Gl3PG9}^TkY3q?r+S>mSXj5a]bv>sŧ9HFvf|Lr8!9_EO!X\3>n0j~WH5m"S (¸*6Kr7n %Ro>~mX~T^cDe,X$< kj8#ݻU9?o͟2yM7Z*:`\}A~Rr'`gKDzv-Us iǗ~dopfIz_Ǒo t./[3U+7.CSpNgaumg3~uR\]嗙Lnl^ 䇃NN {d(y;#.9\7|yr+sYyTtO?Z(F҇v8NZrx&ö=>{253QmWZUI$ ;?O0   ܍ ƷfZ uΩW(E-$+>u$m2 5y)}'#~Ĩ~[+ɾa͞V|nAW⃠,9:LQ3CltH+.@<|SG]CGpF|DikWI|J{~.П{5FzIe?D'}jcQE3OWi/|sȦFVavH$j0ڠ2zs^Fiڔ70Rxt }FMj_Ż|$g]F,&GC3^HTA&VSx};b8ϒunig%RiEt؁[ճ- $O)?bͫǡ;4DZdW=ywCivN Ѫ(ƃ:X1㏠uZYdO~$XOyOIooчfn5z]=jvwS}>嵽j0BZ|@86O :=طDPojkq%[mV%^܇x'_RJǾkFXfnFyIkpnFq.d.ǩ1&@YEi*G]vlUٱV @ƣKcu2ySѵ-XPw dut]?mvZqX<1#cMTrE.m`;y%Ub3!al% ) S#G,k$oA2~c%~Uy+Ǘ5Y[!D}35f#>S^9͊^y;O,}4g:Ͼg%[,u$…)Hl-v;? ~izig#;ؗŎy[>Ҥdo%y󃌋O9>C i\Fx('enՐ6s٩ڹ#]1fo'e{_[yUbΙ(v^F .ZWXkגJH#;W?8b'ek[9!^+v&h>ME){pCrC[v^s{-K/{E^ᤏ#ӛ}=çifceoX[-#V4U™Cj4%ɨϩ2g)e#%bƀYo'B9[Xs&K鏪^O{5sǒ'.lHx?? |姗OѝǬ¶ƭS>t~n@zrOfHv˭2&=[Cx0@quyWYmO=mt$C֠qwn)$ M =$G!Bg%g3S\4op5D:S„^lUٱWf]v5b͊6*ثbثb͊6*ثb͊/vV*ثb͊6*[cǿ Wc9=۲PثWy Qj2L.SIpCq ǧHt/χylO̽#;g9E{kڭshz[D>`n=/QNsχF$߭ȅ&cX1[99}yBW0h-8#՚=?fgX)C-\u-F}3Th2^vܠ>z,yOhe1MJ(G0??/k/~=mzZ>y%}Qǝ"(!N19_h! .(;r{g(|ڞKՌތigjա2\|<:?qY|<huϏU~iCi 6__M&@ q} ew^8'C(g:\s!h|^Rz,)n=jify&[vXxW=/ v01@_>n[7C=7{ii]%R+ɖQdBѸ*d#gnT/oE֟[V:404dݼ3{@{[@Ia(y>qezgK}Ю@w3Ǘ_g_TsvĠyD&8=7\576;+rʚ 7zQʇ3;9;bS<L{nf8> $PIW ?/];˲ԥ¢-sT8G9˘wXfp[FJ`gx#)N1u{iD_rR?cM[̱ -G>?Ⱦ-1}sv-5+71ZȞl:te[61˕[L8`hmҹ i14uLv̼vΦT00=>ϟzy/O4^ cm`^z?*a|(lϸ&6]!t 5Nҵm~G!Ās"Tm_h=o^zt&-oK͊6*Wg!1;!GPA痼wM%ac"b D㖰O4"ŵigP;+n= 3{S6='ihe>ith"x%RF*Z|C .Q^iz*=9TŮ/j ].Ġijb7@-~kCn=2 D:اbT` `zb*RXCOu -XCmx뜖=NP'{٤O'>nlkK Q6.,!%I'9D}<F̣获7fs}ؓԒsǚnure&p }-y.M ֙F1&PM`HUUT1^<ʘ 1Լe_LH)?(h:h`O\kÈ~q{"Z qo5Hi6y7O_ceLpze#Jс$nsRH&_e/WdcNCx#&˧iكq=6..̜'$;׮i72Ay7RФ[rcc?:w~ZR,"KB}VoL5' 5H:Zsb͊6*ثbʥqWf]@*n*ثbثb͊6*ثu]C.8q*UٱWf]vlU銻=8-Ao/$^QP /sV򝉘uvF>홌r?/I0fOo;_#ٙ%7<@>ǡi?5ԑ`!ktSџ$}M&;|Nm¿k+Ӷ}?,,$xcsqq˟[AyV޴V<?m2{CXC 0Y8侓w=Cz\04BQ;1u_4&Sf5&pS8Gr[sw?Ey ݷI[oh[DlgQO8|L۶}կKRicзϒ8]L`?Q2=s |6kJOTX&CO>9F }|s'RW&=Ms6چ+o)}_~eL^Խ\p-:|3a#̽_aDd9/o"/JŽbVgOk{+ace<`|?zSމ#gvO=ElkE5_PtU-乸a#}Ա33CfB|R46a2$!h HtMY#jo4]' ٓɀM=S9R~YZq^Ki%hXsU*GSJ8/c}@dzu2owԯdoo5y'#?>eI+f]Oj '>Ϻ眴[r2C _iyXgPaX&}*&evlUˏCcj>-A[?9ϻ_K9?Gg~[AY1kzlUٱWf]lj68DWj쬮AKVWdJ_0͘u˽:\ kQFuUӊ7Fܣ %(I!\8s /x$?'2ڿg™<9I0Gy"SkX[Uf] ɧS Fi^e"D5HBM̿9G8f=KȀeho'n8GTy3zȸ4ya ~5w݌'}gz?B9xQa.9}|uqN1(Qf6Ohu77KN`#nuoTRڤH#lz䯘}g_z^ϗz/`|ɩ]r%389Nup]sԻg1ܓw0(}175%q%<YR-wNU9ޡ۲CHƽENIz GJP s4bA 8`DbEALثyWf]vlUٱWf]vlUمW+kYUЮSڕ(SMGV -ytry^KNI,$ѻ]S;n9U=8F#% VI9y5xA?7ioRQhwHR7ruK8Q0J@c9iU}`@U>f鳉!M]&)I,~g sq]*)$LRrrPVF.?k~a׵+wZqPܚ|⽸V~`6|ݖT4Ҳ AsK<Y_e/ d'd|?VK|Y_LOI$.G_R%}%ɖ)#4>Uo?wkMvonKGTgg&iAUg.C=^ε895o+XЦVw{]V?Bk:-ՏU cqY!!{o nᎭ? Z$f4d^]igxɿ9yFVVimmE42OĐ޺:Gl *wRu[ۭGPk2\Jݷ$3"##@tG['qr?C7KMJK(P*+/}Ԍ0ևmi;.>_򦥢=s^\|Jǿ3?( !C\I״mVio!8b鞝3c.7QA\Hϰ6_$Zʼq FhO@oll<$z("+3?o3 Y{2{Ht򘝒ml3Wei}77cti9Z}@OX'-Ƈ>~CK8a/PUk2܅;Q.-&PcӉC[PJ@YzԪTP)@_^]ݞPyv:Oߗʶ uYE(;G(8=)NW5{Pu-F̗7wv;I[ǎb!:YH溠g>8Y|kW mhÏիw/oer{Cc@D۰\t,z ~5y#\ѼXjzՄvR3*$=&a! SLf J"\,bI<3tyi_,[oKyG(ԯuF}AO受Eonv$KFx4ۺjqmR:|b<%aοE,W[g sG'+v?.E,W[g ?e2]d|]?/3WFV:A{)# `vy 4j;`dv;ַ$1'g4i_.Vf XX&U`j4p#(ϨߓO@,4+_QaMv3"Q41qk&ri2pOASiHE? dW{v'Lfի_ 7ڢp.w35Ο_.[_ް"+@SuqvȯH6ѭ_WE?PF[xDi.v6 K=Kj2g72SCy_Q4 1^VYoTei?ѥo8J֡V#>ϼ5?Z#b5\}!0Cgx7.­A9dT gavlT;<9q24*L$~4#9=3S:ۄ?3nJ%#H@l$OZo*z~c_ꚾ<[`#4u4oGEǥcb-}f?a(ł/L+U4 1^oO,7xKu?K.i_ uFoO,7xK3}Zf+]Q4 1^ꌱk9CLQ]QȆ2Ud)$İ!ٱWbxb͊6*ث튿3m6ثb͊-z͊6*ثb͊6*ثb͊6*ߕo|/yWcz:<+:Ў$0#0KE=^&ORKQ g9ISXuH?7E}_YCy 1yQڏl_a9{)?t 7E}L:+aLh&?/P{)??o;cQL:7wΗшl2WWuoO/lO/0:KhMlFjj?èsRtz? 2_o;bB_jGkb䃨r{?(t?o;cQL:/aKhwv3SL:/aKh&?/Py 0ɽ(K_l_a9_=:_яVCCGA4`yPڏl_a9{)?t?%v!L:7w'Ηђ?>+B_kvèr{(t?挏ԎCvQw/7E }z? 0*Sy? 2'}c??ؿès1qKh?yv3W[uc9F޴?'E }VCCGA4`yPڿʸèroz? 1yPڿؿèr{)??v%[uWwΗo4c&?/Py-ve/0=ߔ:_яVCvQw3 lKSؿèr{?(?o;cQL:,vQw37E }L:/aK0ɽ(KI|GuoO37U/a9_=g]Lh&???ؿèr{?(?v%[&CaLhMlB_j?qPz? 1yPڿʸès~Q=iɼ(K_\_a9csLh:+bS 秿?!<{7־Pk+VWbG@?4G_ٽ,k=>)Ǝ|ƮUcnG¹% ]PuZkVa2xx;7Qy1ǗáQ'so@p|k{OJIi֦Y"i$տ8*.) ۖ!H7U5= S}= c,s00iia\f >-]c O Bۭ>-zf\]'[]A.^y[%tƧ`[1@KQ@V݋ H/;~_^rߗx!-6$ ̄dÓAlͶo66Z.&,8Vbh(/ 7&mr:mg"#X^DS5X{Ab; rq!㜀mM3#ie㍤sXo}zn;?=4?W]=Ziv?$_~pX}MNJ 3Fwo 6*B(>##B(D@edh )9Q(2k߹xw#ڹ]\_ŌTM@yc]֡SHns9SZՍs^K- k)E q$͍66۳cknMSCg$42vZC-1fb.è5<WK*vNNj%ae"$f.΅o/?y_.yGQ״ޔvD*;_Zm%x#sѻ 9Gfy*kMn?1iiz[9׋m#6]V=V98"c" }r5ݕLv;{a-*뀕fݛlmmٱfݛlmmٱfݛlmmٱfݛlmmٱfݛlmmٱfݘ AWd?xػ>PE>l2z|rcjm5x/fx2dEP0$ޮA1,vhQڡ#ŊbC#&9BPr+ o66۳ckn͍uWe`Wf]㊻6*ثbثb͊6*늻6*ثb͊6*ثb͊6*zbQ]J"B`2>$A.KmqS4/qT,)Qy/ v!͊6*ثx-湕 &Y $bO`jS 492@N}"˖Wi:}P{ qǟ,a $z"ʊl2xz4{CE492-+VQ}%<\Xsb pGfGRR(AA΋gvku/2-+5ۄؚP85䵥ܗ`1µJ[M<_?cS61F%$"'Ą6eLRydQcΤzr Glc]yڝ ){?8{5'9!61uFzc1k@sWvwgmåːXԴb+_-:?o}XfZg{K}xtĥ&4|yC~nR.d' 'JfW]xKFBXtk%p:k??>|a~__-#qHQdia=DD8؋\ww9Zc.3ɝGCmji{Bz\`w80|?+jnMƓq_7K{X˰4k583!pTx~_cg-ʠ^^e\ѯcx>8.t?09ŵ/,/Szwe)%ťKYo\pfc1VOHݺW{qpkk{~jC[]t>̀Tc&!EY ˠv9lϒ~:V~QκYEއz6:~;6I؞8DYk=mZzh)y=&W<9?|S/g'Y+j3酆Tgm+=Tx+L{YٺɌx3FS[7"/r{/i,Mw;"fcP c2ɰpl9GObt~\d#4|YCL0hs y/h_cE{mr %On3'U'fic4bO;:<"[9#Qu+V{-JC 夛4nTi$2NyQ14[$e:yXyGWh&e_MvOq5Gv SqH[Sh ȑqwU5&m;4#.G]|sv767^[ku TBΜ0 7{Ay<1C47qD_f5ۚ7.1h:yq_ʖz%rHZ]CQ"z KLL]ByDy(5ΐ4H7no/W4u!:||C/ߚvn|<єZLb!_Oިw1Rwlv<3'Q/hp3?wnt,GQlx BP豌ͯ&BDEӉ>~IO*^h&]J1ri_dt M|,w ϓd.$ekD }Q n$$ZW\yrzV0n91W1Cٺ|#6LMc~ZzM/*^i ̩XW-.Q?.sa;={Z:^څ6v~˗q䐌{V8fTxl? l?/#VUr:sS.j#n_vs_o<B.P!G:-M`''&5!KLh`-Ⱥ^!(Iu fn,&6Y ,5QҸ3󏟜qy-N9''54 h|2oݗ4bO-c(r_yj?t+ QQ_!RGfA`|#Rk=8Ub_~u w֣ B/fXj͗O ,)r'M= Z4m vhL{q9{-ظ;'AXG{O4BU :8*.wOT|~RQM:!LjCh{]9d. y]|r_#_:VEcHnBacm(qi21Ն]6L[N4Ar)(:zW4KrNi̭V&ifBY D[u\#fo[PP^ֹbg>Rrk]SAҵ F͊\Υ$F9ɏ,LrCA79$;6*ثjvܵzvX 5'lFy&_JyIw3ݍs!Èpur6mdlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUaC_J}gnp<ꬭmY?;?c/'ۖPi"XU{r%9w=?%bj)/L{E5=q 8Gl>wv>G"3֬^iϥ/cAR׈'a #Q2y+ԇgq%,~ϩPRZϑnQ{^ˇvU3Zo_/G<MI[?ē6ڹ{Og^@FN5Z/$w2?%5Ȩ|OH4b\L{uUl S>=n/kKZӦc٤PkZ힃r#k{Yk}E: "mrmhN~,`qKȌ;G䫋mB2Ī(W=sۮq!fCKVHI=KKO_*Am/5SwrAm m)zg?bayQڇWcںӂyUSq^|(bSi #s}qv9pM|t#N#HmZQH(]=}I|'f";Y^1J^".._O]V8$$|64tl>X2_<EO&n"~/(oF֜m4kX@'9<>8jgr%m (() p`V'<9QN m"pc)ƙlN~C:Ѭ9Uo$ŵޟ)FpWDw1i-ng_,XtbwX e)6';?_W:yRڢ\BoTga{Kt_xx..^]B:VtG8M/wV rG{ $X@;oyEҪ3L6~g:]֡is?mK9\BǸh;/>QORq?:~}GecmEIi' _cJ3F?g5ORF>Kʿǒ/5ھz3x0WpSMs _3+ɮd[8eaZdz4j-> 4Muu#9E@决[;:-tfqHc?ON˖UbR( _zKRf[q..$֛wicxmNRs}cW uCWm!YSB];G81c|#a}^/gHO$}1?sG=fp.$ҵ=?ߛv?ZFwzƪTbH$19 ؙ=6Fp~ Hc,QS 8<{~x 6^¬Ѳԫ/CL =Mn3BD'R@{ x?Z$O|gomkh@}M]{,Kˈ~w73ߖꉥv-چeOHߏQCgvhg(Dw;~ i٤l{3l326>ӘpwiYZ>8ih٭tuhZ9 'yg59(&H#.tC> O/Xz&nLyE6u?M3ٿGB_##.'<{[Rlwj|\%u/k_5y^ӴFImp%tN4nk<3;%Md"%?:-9ᜢ>u9Escyi4Oh~OӖ3$^v*F=SS4|Y3NicŰ c$~_]lB 5};E[>(Co:_c!;Y>ϓ,%Z\yT"e4H o/krH☐98ݍO~ݲK 叚yIe;(Fn΃0£0O7,;"zq(AF"@5ґͣj/,$@+z/!f)mMSW47Mn@=KC#t}AaI8dNU<6mچo=_#{d:+q5[4{Sahn~ ng9)?>JLq# l}5MQ]Ns랬] _.͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊|pe*R#s?I'Y )o}}v*|?u)y9R'Q6Άnu)J,+|槗u-]࿱Oڏl[P&9 }4ѴM*cmr$4ϐ~a-E79B[G7S)+@ {y/N&`7sY])b ;&^=8mo{ʺwk ԬlEr ile0dŘK,Ȓvvڮ$(QֽrWkQkiގ1>t`)Ģ|3.)JɳWǦϸ0m-k:6` jM;3OR 鞋NfŃ> L`8vuJ<tʿo?tkkhW6KA(M+Zs'%l|oqZo]1Lܔg[olLcROHysG셵wiz?{]GYK+sxm>p{ۓO4jv|3i^ZFw_b=쾆x5  smyd9Zgvo+M"}N[CӍczwE~N-sn9,T4x8 ݠk?=c֮=_^c%޳y-,[>æ\0P|>D+D\8>k/η /6]C3c??& $VQ޾V}<߭>Yb埚Dr;1Hntx'_Dp3E~HZƟV6)go=ɨ_;dwf$UcH4/H':U}VDYkM`]帎ӐIRqF;?QP2 ([='d|?\wrSo9mi@Kz 1(xU`bCh@&=Zc ԧ+IP6]Dj^U< c b*+qʿ0^i~d󧜿^k.=AEiN|ۘ518cjq; -S@)L9a?;2{ &L7N!;W|voaD2NjG>g[*k򕼝Gk,4!yB6ݳ/$|^90ċ2i'˿wHg宥[뷖ׂ>3c=[ ā|SԈNd?v}6`e^>SBW~ }2KnNp 4܌)Gy}+VMPN)iFRVrW@ƶN?cj!d.|Cq,^y?3~do+WqщS~kWig]T@]Gǵ_^c?^s{"5t:1F}i{ArR3 F |7j}9nsϯd7x|ѥy7ȞaSMԣԍGZM?Q 9Yddɟˍ_vM :^Jhzrϙ^P15N)po*,~DNTE~yiR\jWNWuXbP:o]۝vQq]r\Hhp^a%Fyp/EY>^Trj)Xгwa;#Yq&Lte]\ώ9l l^;~{/7kYLHDs"=m0-0)Ki8s?'-ߚnWՎk^YgbR;?ӎ<5EQ󝟟]L'@8ZUjzm^䕧,-t4@Bz;BY;hĐ2!v8\ 58;O"kl׿2<%]ˆJ%r3'-n- C~*#]^N2s5M<9;$_󘿗HZgGv=]I O9u\ 6u(dˬ4tSCđ0K]ۣ!raD0=PT?T| c u m=1ɿo՝>Q2=W?QsRrEzi鈀v ;?iGf{;,ؐe8]Hޗ&ȝr˟3R ftg{!P2fg/A#)4Ϸ/3{ aSk-,r(9f-@1]Y" cթ+Qkp7Z7 ;c،Iwػ.8Q2]LE9,4/"i6~F5]~8u&{-y/:_`+d$8u"mrPT;w.#S1[yNK%aQk5 `FԮr"K6KMJ#~7f [sQ|O-,#l [tl g> ;1@7?K,ci=3o?~q үYlAA"΃\mMewxn_1# g ㌻6*ثs/#Q+mk&ghDvjgO?iokNxr9`od2VNWumGFK܆)"І8r9ba0= H6 =nΟ󓟞f,'Wx2nݕ)q-<81DDw yH˙Vuw- [8$xfň$ο}Y[`B}aw1o̸rF($]A᜻[6K[bܭ+oX#ǜ=ɷS*~盵=O_ꖗrnz>śf|ŶQ"u0~kκqHo޹ j@pB:}60#ïɢS&\]]A4yΞne58d"Eoltz-.`{4r&tΓ;~`hvv~ol4)gCphF(4Aϟ≕$n FHDMP6Zji]]N+0vMoSF! Gf&~j&?3j7oow;HhO\Eb_P(IbkH__˽[o`Zђ}G%y?=gOrbgRS%]铟#,yϱbL'{ ORnJ.GjKoj΋I0JB-}M3#E]pa4}DPxdFI29PGBfi FCnNνB~s֑鿘ͽK"5-\g{s)Ir#E/|yWg&3=><81ST|j>ɫrU/7_R8ǭ2:[C>8ιX,okm'o<ǭ]kZJ; ] =&<`!(,fm)F}=ɦɮ_1R8َ֔;'D' 0u|y[<25973yc\ЮWrNքlUh Ǹc$&ɚ癿42̗:R5ԧ.E5{;ENi\6sg8{M^2+Kij)S]Ϝ}}Na.2" :L#HDg+/-to f)S[Ez֙N9Nqwg(ۈxg0i.n{[ŝ,wͬj ȞnΗx~lwL]Eޭa";jv3S.Oɂy U .Ϳ̽2k;ڽƥ h +w˲N,Dg1(lj2R.¦_^_4o_iu+AO:6cO͵A'ϞnK3yR,q"[^Nqрc)vfG.,{&y?x30<`t-yS4Cii;DSE=rZjOlQ"@AZ$km^_0za\?DpUpbrHˊoOO4iy:Hy#%zl6M?(]3$tމMsw:s_E.dh}*s?Q&9`$B ISzK뾴67_Ԗ̼Z?0Oٮ>1γ1[Mu__Iwu-̧ݏ$~T@ǔSt+~y~l*,+~T['dҰBB?E$L6c!mmkZ UT*hcC>;$v^N,ߵ#)ꄺ*viASN Ov5z+iX^%NMh<j}$E 3~d#SEnOqev/NCjIn.Rٮ4KgEwgveeeqg?0+wPx4jW~I@SK'^HmkBYǩ^P;cqULثb*`|Uyg1I,,] {)MP% !7ʼ6"3#K3+1mvwߕ2B׉mo~zzeS$AvK[ qȵwO.XJTHsd Gv%Y50PXTu.N5ݝZe* epxØkE֛sjp˙,g8]]TXM% Fgb#T}N5w\!ֵ{ w\,$Lq=5Ȋ% vɓlvo]vlUٱWf]vlUٱWf]vlUجSI"vE5WRA"14Ev SJOyܘWTxI/_`@ys3{7:y:7t{ ^K> K {rXgdz{WQe*մk-jk+He)ϔ?}wɯhmVxP3;SټyEw';V#yk'ɣ^Kq%jzam^53>[2y!2C#R)؃̮I(8D=EeyAȼ|{;fuE,('mcryj(dwr3hqi N/٘ɨ!<<~g|^UG#gGGPϘW3Qʫ(6jq6C݋0z{meϙ<+BE5쨽3RSNP[?(y&J܅*g?wi=zQ$H n*vlUٱWeA8t`@#le2++)n8.o+n8ɠ9$8fz bjH1ghGYÇo #2PKr۹=o1Y%jޣ5͸n *o  c!49a}9+ 'C$q"DHԞ.:qO7`|vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWbxx͊6*ثثb͊6*늻6*ثb͊6*J$:mQD)r];C9a@fV v5 >~Y2^T6 MzA⽻gWXMrvm8[ƨ3UFAETZh}:_Y,xCN%}H%z$eSQ^6z't ! [ oWzRC Gnkx ̓h19=\{g-lcq = vvEEaqȷײ^XII6me׆pϣwLOb L؎V|0GRm˿4uw#o4U٢ҘLPj~cl] q|{"WUtb-.Nsî8㛭π67;ho+vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWbx1Nۡ08>Hxb􋦸xYd^;d0;N |utL'>!~%{#6<5jyAKmƃ!1ٍ-) . Xak}. FU 3i#kcS 1ک4b: &bw.,nȱƷf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWbxx͊6*ثثb͊6*늻6*ثb͊E&$@g4UVylɖz}UU "ggb;MK̳6V )0.^͢iǴ !5qQR{gg] nݏ!޳l1|~HGfn?(baŷvJvr%_똳j!>,]NG h)qǽ?3yv8 {p].:M8w.,5;oFy4W2yO.>k2WRpA$kȃz!"M0<݀A? uChiE*^Y*9vfR2vc*ݟ0:0Ϛ}oc4&eyVS^KL|n;y+b͊6*ثb͊6*ثb͊6*ثb͊-Xa\UH9.?0&jڎ˦BÌ1S@z& qc4\}^"Qy; ]ҽb}PҎ {=BT(ԭ_^:/>1/g''g˄4`6~`s[$::.<Ȩl|o +\Mv(>ocB}XLxݜ韛GA%Ǭ7@G߶tkmONPeZϔylݟ @ϭum.5QW rїup&}O<$S5|0B[[pMP݌~By`01!#uXY+5ʂeVާ"t^ l,oaüAok(c*=H`濐tey:WQ8(?_%iP̺`QP}6j$u=I0F!_@ vb%z$%A yWF/" C<<0^O/U4/? OO[!Wǥ/<{呉3r'92w%1dž8u6au.暮Ğ<{;nN# GywMH ɮXbwtʡ)QM/㊦Lثb͊6*ثb͊6*ثxb{n16d׷PEvGw rpOQ(ό;}uSd`:d ; #UK,m I!@= d@a-ֳ EZQųE#W:ұMYE'hʕ K'aw?MGyDjmF+:qc-5~;NB4{gj;::ؖ9rc Io-iJqYOCw9IՓHeA߄{N1-]B3}MD~K# |O.=;K}&\\ͧd qrN6mq"Jg1cԛ.x ثb͊6*ثb͊6*ثb͊6*ثb͊6*tnѐTЌUJHcZN R,*bڷlu`Щ'gE3oJ;-<@lYk_z}b- gT?=\BQ/n;ˡ&?D8tZm@#&89*Ů\5Ʊ ,jAJ9w+1ӱ=ɮcܹÄr KN>,+ڟe \>ǁX~渪0(`;fWf]vlUٱWf]vlUٱWf]vlUgl6f-;ĴVen¹/erheŸzF+tWutweu߶WivO)mE^jƹcvV*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊]vlUٱWf]ثb͊6*늻6*ثb޽&65U%\nŗS;OUX Iزj֯-*;ǒj&݆vNS(ύyniC困OӔg>>[\6ٽHdԊd1-݆z>[Ix-|NܹpXV<}^Z 3+;5ҝڙ`0`BI5&쬗Wfȫb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*4VB~*M~?]&v1.MO^B(\UD^GA]vlUٱWf]vlUٱWf]vlUٱWf]va)bҮd.+"2mn3,jvV*ث+$Ԝ*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثbWf]vlUٱWgثb͊6*늻6*ثb͊6J»6E]UؤmFŗmٛE6$-nC9GωӪH;n/LD-C8%j -3=W*0:3kw:sµ/UnJdaIb͊6*ثb͊6*ثb͊6*ثaٱ"ٰ+b͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثbǪc#4dF6;AIJ\*ے'"YK)T-GޟC㘲K)??^PG@ j~ {1&y9ҸMb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊]vlUٱWf]ثb͊6*늻6*ثb͊6*ثb Umj2mv[8}VQۭ)sM| EzIo2v5߭i֨O"?~~]%k)۲) vlUٱWf]vlUٱWf]vlUٱWf]v- RJ(޸D)=[&z.k巸`?iwP%XFrDm"UٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]v,I%k[;ȯpSR#A#oHk.eX$Jh4в*ny t-@-8޿S(d=AM ʏ8D M*Tgڟp/k sMlQHgDԯ']vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]v'7*ثb͊?ثb͊6*늻6*ثb͊6*ثb͊> ; Dcn]3 A%AxW`nvlUٱWf]vlUٱWf]vlUٱWf]v, @[tV$FBE<lܹAA.ֿ"ng3qȊs?rr49ڞne`Wf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]m,*\ -;4WjYlݓ-O[}hU$~lCfDg-e)9v ,x]Zր@G̝>h>a=-Uoё|2#sa[IZVL8&]ynxekg_ 5 NO7iyVҤ^&խGត3aPGEk`lUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]Lj'vߕO%3vK-mm9[h;bJes$v H*iL ʗmlE L/ll;:F)U 9!ɔp*w g7tk#O 7?r8&[Wq9{P$]1v9 Bj69GFT5ѵGAoIc~{f>E"C Hfh52^lǹ9QY 2iw9ڑ4~T Z醗va<2r-( Ӿ_Mvf6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ث8_{/j&B9f. V9Q,P"˪|s¿wm7Jr/uX#?e{;[jeϧWG.\+}=Nt'o+vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlU؞*8b͊6*ثb͊6*늻6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊TIvirG%'B6X>۸cP@4ێ;ߕ46HL*p~wqzJy۲`(ams "ݒRA;c58.\ܘL:vk[Ŵ{Fs1.ld$,;*3 6m%o$*^V;lt<-9quEeݸtCFˆ&Hmc3RqϾ`- vMxQ|5?9kwz֩)yvU=GǣXE)lȶd6*ثb͊Ky$)ș-om`r0vcej+B6%ft4DIl3Ra^b G;e90'd"Κ NI ĝ6V)i݇JoHRCChԨ44'`{TOh#34Ն8vZOq0E ‚;x) D%q.3~VG- ıg5# E vigV;U"'HBNsFy [sϿXO8뚪UA:;>p3k,Ew||/u˳ 60{ݛGkH9QvVvlUٱWfqH6*=,a{1Xvq v,A. ZWj4TBPGrGgau6@9!H#22Cāabm{ +ϺAU%cV{g' 4Imt߷yS>jtT9ae&KoiM%F Տ@WYCg.)t)YF#:Z0 Ux&'4aBk9T,ؤ0#b);'dlE2]2G1 \rpb֓Hy_-ǁ*~%}c;4grX]<->uS\J16CbmBSvL,mWl mE #s`a#ѦIJB9P94'5C/:䞥==} =D<$'N2V#ث)o xC> ;еֲ [JxLDd;:C2F *.nU)Z!"94!IaF6ZY^Φ~iȞH$HGt׻+6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊]vlUٱWf]ثb͊6*늻6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb޸DSq1f$6mU,g msĐQ!L֕r YZ~Y"NãVVљ'`FK7AcR@٧g?*?-Ź&~#aO::';|\0/s Wqtq(8 <5pt6 GnMgzmq˼95fk>Xi3tǯ,Ac{1 *!5 ȦA$RtqFS16m*;)Pvݸ]Gc/n=5|iңҼթ ԆՇB|CWٹLcg]ThWA9ثb͊6*hpv0ڇ+M3vJ[U6jZm9%lbKߒߑIpz0N<3='{鶲S+K]5,`o63nPOGo,NM+$?x͖h)D/|o%ȣVm1 cLN: kwhj5!']4|B J@ Z ͮj\cX-DtҌq3;7}7HLv'3]([!ɪ HԴ:ƕfLC0 0f;m}կ7ci5sd'J&D5.j3X_QJJ|.9`GS(  ݖ{$ɩƂ+vnPef-Aug1K'a}no( -4/1GjvO8ܚ5e|gv}OV.'"/5;8ǸY$]`ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثbWf]vlUٱWgثb͊6*늻6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊5+*:NIvKj0mZG@ 7:;S1s_0y7E7ixtȅZi nS\\sv<6L2/|K#=8%NOOju'=;*@]F1x~so.$YE (mi9Hh.A/-Ayr ,DݚuwhK>Nc8niZ+C<Fu~Ò#}Ɩ3mo|kuhHXR7͎,1 c"hGr[7VK>(\|x.?0y~˺d'ғ]{s䁁\ 2gf#web͊6*%HLUgo/J&; R"^LzvxJa}ƭ#FhY 4Lj Y$$D1v%A]6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثbWf]vlUٱWgثb͊6*늻6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊y7#3@%'3Ǔdbi:MnOIXe&u:zQ"mdGb &' Q'ate2ق8nLm.!7>Y^SQ+;(;%W“Buc> vh 6e#O[K-= ѧIu$S_MO;7gibgPۛJHrY$S@2'rKvlU`h78-ya`u2d(ǽ3UEیÑ%4l3v|A.;'aWSvI8S4V؃2}ه(nHZέ~~yO ؉O=6]CW 盨F~2xܟ{>$Gs]wd0sQ/%)hϣ6x' `7R:t_7a]ݍ=sg M;!ztlm!? c<6Á?0%5]"oQCX̑\}07ݳoh "'rj0 D> U%PҠg\p<ˤ;r_r*ثb͊,;/]] 6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثث\Rq `vinn\WFDB )SmٱWct$Zp|rFDӰ Q|m q|۰,'z,;A9" rsy-iEbԩ2H&݌͊6*ثEf*|r2&1StQ\A2;ֽ2Ƒ meRƐC\wdxlCtwl> 64T(;ò\KUHAVQ Xt9ew=DcFvza9;_2jO2Jc+USJ(%"|&i?\^S[Gs Q\S:MΛ~oyXEGk#v=?OoP̚qK[}B \@W]&A@LF"=3E{//D1RCS{{g?=FL?cM&9\ 8k ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*OvoUٱWf]vثb͊6*늻6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثbvnb͊6*ثBEp=2 gVK `vnNL c#nabثb͊6*ثb"WcĎcWbr!(ӰRjvU(`!lđLECj=s[2AlAYn7as6 SpeKsÑ1%Aiy|[Q-b+XrVj2c'kzg/hY7B1v\K&LF# f]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]v'7*ثb͊?ثb͊6*늻6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊.Wf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWbxx͊6*ثثbV~Fe@KQu,^͢sy x`fURnTXBx_i{S>%)@O"E(nzwn{;&ϳ6oKO4/DzXkuϢyNnlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vԗӿe}{sjLzF uOh?Db79rgspb<<7- )SPϳDyy'?c"?=Obr~ൺ,'p6*濚ߚQmuށ-4&=kB]O$-OlFNGh#zNQys6ǖǓ!t/hɩ5;kxڔ<}0veKTPꌏ= N(y~-&rCsSq~t_:iZ3ڃۥQJZ|Vn'%% ^Sm;ECr#:΅6p eP7IQ,Rqnt #< ,on]ƏY LllG0Bg$嵞+嶴ENs 44LxfEG5C Z 6Qx@81)wZ$?~1>DU@j! #OG]'LS/c>^!VG9qC'^eF c*y:%,̷yCv ɫ>a4*#mBJ݇\v^۟I~:E3Yͬث_>B֟ȾI52^afյ 6ޜHV(s=~kS!O15QGuӆ#. Ds֟5gȟJXhMSPD;p$iRThDjegÄ3.!\$̱LaV]!|oW䥓(~tN5gl&Y{x (P> @{!sbsi2@Ğ#<7ѯ.Mnjcݻ{lAr~Ys_y_YcoYebGix:OHE'`iZŁόG9DT;$wn1<'/V{k<ٵ]][Y[\^^\Eigiww3(gwv *Mb $rIܻ>^yr#+rw ?qMQr_7ilոM4N(k>4SJZ_:eCdq =8G)K0..&'a_]Jnsߒ?Z@/s7y}NS!xϪ_Ǘ^Y{喣m#1E>AZB5y4z]$px9% In<cỾC'e9w-?,Fp{Ys~}HheyG]u05WCcŞcb1ч/jw3~OQ1q/W D ؛t}qh]˅lWp?;/=~ukVLuuLض"ѕ}Y k_Af<^?{t:]iB_h^-fc0'3|h;gӬWx>Mu{~} z?46 z.%b 7l7 }6E.sd eʼF;WU@#p>~R^m0<|Jd_!\)%ۂsǻ{GkaeqDek\9br蹧nvlUٱWf]vlUٱWf]vlUٱWf]v|jwO%~^D6wRz~&8췲~Y2N33) .|Ā9^Q@Ur g R4]&YNZC6\:Z?N J]+>ǖQ.8@/cGq|z8@$Q[B]vlUٱWf]vlUٱWf]vlUٱWf]vlU؍͵vWS8H0Y݈ $b $=I˳/9_g>CMgYi6)R(wKzPk} eWZYʟ>{'S|׍b$دf#;`%p{Q;3>|g#@c)a緢[vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]HU4a9J) Ϯ9~lUٱWgb܆*܆*>5oKO4/DzXkuϢYNnlU|Q8:wן)x[yw鏮E94ш脵W7z.ϣgb \}0gTD]gk9'M}s[X4M#1QlbvjJO=g P{22LJRNIrk{'srGRiI:yu]Vݸϧ\@tՕXnE Swcyku1ÈbyO'=::Xv]8!?`䅅~zkiu~IQTS*0_0M9fe5,GxDT#4.p~1Ts]ثGY/kyWYOQV:4yDAh'VGFJ/OکZMAˀ '$=m{[H0N<=8+9 qnk<_0j2M[\HH9SEf?(v6999Bc?6۲<8eG HE=$u//iߖHԟNUmی~ l7I.]YUP9cyku1ÈbyO'=::XkmiQl ϸ$,- K^K_WKL_W.R4\Qi4{/D d;'"]It =i~P];ʿZ}" @::0zQx^Otrj\Q_8oF EDO%|],Kq")xdYaHeCUeaPRQ1$z՘E]??/]{r n4&[jU$l|W;z@ ιWi;'qaxe3t⯇+ϡ__U=ngjߗLѓW6wZH}#Ŀ< ].9爗! ;~LJM~{<ڵ0ڽM~R葛c` =Dch\{g4=^.ŌF_!t}#! c?}뗾}.e} AM,8*yRv9ړ=n]VNy$O4P;|(nNVwg⎛{0}Լi\[ږ I$AhY9#e) sfAuGL9"u7Co=yK^s=Oj-u]9feXYU$U,j0|{GCAɦ\xbk]~<$D"-7gԭt?2Ma_Xe]K%$+ x1(/3JgUnc9tĠ%de*.Dr&]М!A'5mmaV+Tݬ 4Ĩ}g8I5Wva ۽S!??󏿖ڔ5皥Nl/,|4*䦠@͟c۶OC#_4e՛b4M-C Ӽ6Dm/j*1d/znjfb{S'Oocˈ ۦbϴNǛ#=lU˭oY֩-GU43LwI: `EVB=vhhcq FR'phqK-L$/vNu<m̶5 ^$?)9U.ϐ2āPqDHp 98u0Ɍd{T:~ 8jϙV'4%;pw}98 M^o? }gH"Jp'OS=;.]%$ ~d8pMd|ǡ_Y|DT{g_? pbČ]/pv DKqҋt9Y6g<?qD:QƩ4hkBD<&E1su8CKpx}oO,i^qnf3%e Ŋ:8WGFRP;KuS ؂7l],(_厥.y_3kVRM"іIe ! {ژHbyŒp F`ɿʟh:ϪiQږ} Z_M9 F +£-xOu>D ۦb}qS;sSXWkZg]cZаѴ +GWegM!T NJ)4POlÈ\!HD" טZ$|1jmM\A*ZmjOϯ1N'u}2iXң7V7+/&s.xz|r.#0ɒ8Ȁ<ݞ7gKqwgO:kOU ;s&b+Us4#Lx1`'rv}|Nuȏ//7lu-7[ KGA Z3 F$5EE@ڏb;Cj8e $_:6"A.;9:Mv=MݎS={յK KԵVZi=׺Vadʠ,x@ ˰`|rMD" y?Hno$=9p% $MƬfv>x:\R>9y#̐\8h5L8ͫ.`g v]- r*4}v8q?W8:{6kjRJ*J*GPAqse0MD~>e c&ks˿>Df|;Cnv^fǖ, ;W;gvM ; y5r c;B%R6M#?>9_̾I,m4MMM^(!(YU zn$[aM-{<0LIx$s"Vuup7E3g4䵞-G'|mԴ$34z~hv?MO=xrQ"UGȺܽFC[zOEU|jN\\C&Ki Mqq63JG_}ȴSMxlu}tb͊?ثbϹmz^|S؟ܟ-nO<-͊6*ث3?/?y'үDJe{VQYFVvd,>/E'kjj"Q"cfTp'ya.zpqoȏ%k>j?XtX[H4H(lUA`Xv-E c!ڡ|?ӑ?wHM!f}Ghmz^͒M*KpZC Zӓrs=XL#@H<iQ/-qRMs^[SU/!9gYe5f_|#`z}<=OSMk6*_ Cտ|2IOG uY$=#aP#8p{^7'Kc|vW:gu 7=TPh Dxkq4ry 0{UZ9涽yL~fv䦕ukRV8m-!iɹ9coc 0#e"~s2KgqRMs^[SU/!9gYe5f_|#`z}<=OSMk6*_ Cտ|2IOG uY$=#aP#8p{^7'Kc|vW:gu 7=TPh Dxkq4ry 0{UZ8y'o{ٮyTX*8N¢g;Fs_2ܸ>>R.3/w7?95)15][Y^dZ\a{;IHF J1.sQ؈#g)hz# b.̶XzH>L{z>T_)C8&KZ\nk Kґ/'c{>Љu !([Qh?-Y1}̓]{pr7RNynS z@XAt=@QJw_< ~=\r`t?!Gݽ:;N֜"_T~p登Fb͊6*ثX捜A@QV6נl{,r=ݯ3dv$t]˗=k8󏟗ڞdCvp{Ow]#i sjƠ򸸈fn I'l˵#c>#L4<#ʩ޹Kp͚Ω]^h#]VV6R ӗ)CK\$h1`G]s T{2]vy;/Rt9u}"k_~^Fn*n8=obF5l~0M믦1ػќr6*E?8m5vzjwU,o,³H +^N{SR&<1ko}1 .{qkYs{yv!h93r6^yMZWMH&YHOJĎ;/isJ`H☉؃pFZyAmSp{_.'6u+8ݢh(:\ ?# PytLdjt9sS {"+$^Y!Doz~+{_O4ձO$AtSYM4#Wh+ylDC'kJڜ?y]Wqr˞R59|>%Ɵ,"KA1Z RS~N xg;Attڡy+gob6*?<'ך,&ZK3FJzu9F <t Ier_1oH~YkyXBB-tz NI{έNzߒ D>Z ϻ-cZ䶋Uu+-kOcRG*^h,;.aŨ8&'@cǼ>gT$q*,H$*E AA χ*5+OӤkoijOku2 (s*૟Lo]?feǒFB6t%kv}伿mcLki:XϚ~ r<?~AGi\sA,a~`ЕSgWl@c kW?2{fྠ\?ߑ(o\5km-4>61G?'Ԯ'$`A19{{t{\:Yc[GvtES?ᳰ-M}8׫?<,힫q,r^Ok#sDMS|8$Gp!6$_=Oecy!,ᑉKXb>dq韠IVe3*f!UEYqM9?9Yo5M Ce(,{Bu=OMZGjWe`G}g0$_Xjvw:vgXƲ,n($n S<7Y␜ Ax!ߐ>aLo}dcyI#5:un-Zl_GN˞_&?D#@ ]Q(lȯ>~Ty/:~ZyQŦ4+ Z s]ۤ1  tGEϧ22(zy. mvlUٱWf]?0g?5E앴/|E ㏗+9Q8!;FWҿA^:g`VFF{5YGjexjKp=xA\pqSO=E,m,˟~\s\jO=ąn&_5'EIyrzN8[291h|1zZO?+4oɺ|ڵ֗wtnnr?xH:$q+W#*k=M2D8eKh؋v{'qcF9ד|wx1%~Z]yBEV$-7Ky-0zО5uF˨0"&{、#\Rmr;/c8\;ov9i[Y}FR-^=MezP? 4;Ӆ3܎A)rmx`{ͪ8jo3Kfޯ4`%Ƨi->1BQŒ>\RR!vtN-Xq# >gX6*U? 򦙦G~]6/iK{uhҺ&8R4ϧKɗ |,~Qጫ"ݱ @}zϡ󄿖~p^e_淚.V&+kk`UMy./%kxgˏV!_6~k󭟑oN;3 qR.pqQ#vvS2xwz|3~npo~Xn y 4.ќPKm<#hE (tv6y{\d$<Li{c]@!zϢ 8a9M5oN2eҴD;66v/ԡ\A'<SvV(iq2d0DrwɱL|[_ >L1*/Z@!E`Lg>7X8c [1/tu1z3uǔ >!lYc=~tϴҭϐ󞶷_~[.-֘BݵzC$;#uh_W>ݬl 9_^W</CA7};M1=٩V='<3_ˮde7<2>o"9!6n$u*iۏ~w0M%?jK\gO6*ثثbϹmz^|S؟ܟ-nO<-͊6*OƳaOIbgMP.Ԇ.yTc>7}oصZ|=rی2=O}c;kr=0qq+BˈU,;'f9r~DI3|o8*nݶ/xZH mm34=o38s:}ݍdmKpa^rP~& <8g(q1Y,݁σ?˻(}_y@EDzԬnJ Xcd"$!/ ^Ǝ ё2nckv ]$tϥ>z㧔RdmOV 2m5܃srvY/@ﲲiCkn׆x$bGdL}ۘL3tc},էorA Eӊx|sпڰψ@F5.0Ϡim֧rzfBIƵӵV+]L[wz;Zʾe=]9C<HK}嶍i7n^"v U^T"<8J=r'q?apB"Zyw3Nk 6o&_~Z!VģRT='= |f\hY:.ĿTstϺYԬ͊6*ثbCxߘE u&Vє-qfk}ژ5WB_ԗIqx|lRxz6:{htw1vW`ӎ`ncUim#{g{gb RI m{L38]Ǽ~>=8?7rn62ːz<ϰ:yyK՗b*ݦs!}G5s݃Y~}{}.Qro0kz9}AM^esJz"E^<1N<$zpX/5?:N?̖MƴPm^&7ֿ"vafv< qA8~/AP2b:U3h7^{]'珚52]}Y/C並/Uqv~#&(֠d}q;.99\|<3ڙɬث_% G(?.^ůgoqlaS9W-?j zOl>뿸:gP?n3goMIuKvϨ.n|Kč#(*L+LH>xy/yޒ<0R?2jE?-3O?%v\f,[W r?Ǽ=sͬ帣~Wp>q\Ϧ;J$OBa/1y9>jzu uo=#x4PE"ݟ|B9%cO]G7sUb'Vj~@s#r3n{/ 3=RsT}ys,sGȲ*T!C)GC*J&&=jU9jDuo7G^1WK5&XeDzĩĵ?gcvnG1d"<︺։ϖtl ϦLŗo'i^ʺMg# 3e@}%OxhgO9HI.806*ثbπ=˟:o2:Fa8Xg>>.~<tOc'?B>~] ȞQimuT5ц#F9/kt;YM>xca2@Hu 2ef]vlUwa8Z3,:ט4+XU@#K1̏~]_lH?׮ϸ[[ǹaaw,v +({e`,}$yOHG1isu|畻fß+Ƴ,`/XKI?hz :H%Knu}KNOq~\ϲ r|7Ձ$:}Om"swKߠ6sx[<!<֟tK=o?/x?mp?>zw:gL>rCWo=ߥ:7I_|tQj?ŻU~>~Ϯ&n; 韼~۶}T ws_Y~t;mP;Ҟz}Ń2:>}y9>kzeWgşʏ֧|` ?^}qy>>gJ6*[hw?ѣE̱`ki\wUK'?2#Ѝ8t'Y4/+i7u-EӝN)4䐪Al3j X`g9rA$0#A #:g|߫[FƗ0ӡơrG0gmڼ1 ;c6Og%0f|6/5EIngѫ(۱ k\#f9߹ޏ?y~zcY^W]R6V=O Y"{ މu=?%?x\3|3bωp?c-Z)@aj>aj?py}z϶k,+9#M8В/%L֜g+{";kG_tmoFxo}w(1>zotԟ_a}3۶}Nwsbό?>S ?#9;Rgu[c+b/r>@Cťϣ?wsT"b;%KmQyt"o 3.^e"n4Mv ON 1,ѹ'>|i2iOASH4G1(En|ROJ}R.~[ ‰ \(= $IQ2H:n?HɗIgWg?:4u?;Enťc~v3많_vlUثbϹmz^|S؟ܟ-nO<-͊<999ǯ&5:5xcnUAcDR %{?b\p|͏ӻ8Zltоr<`W>dKkyC=k厥o?8=ם1.HV|@U>PBO7v,ZbLwv1Y1&Gq_;f/$_LoKC.okB+"?/ɽq<)XFYZiJF ޚFh{s ^{)2x2$* Yzɫp5@_]JG?# &,/g(PH IXxg hb'iǤG8jCs@>CWGp7nIԾJ@[}lZVK[ cjtHy*IR=]f%yT||:,u[-*F% Q**'x;7?i_VIQhnI,6gAe$'}y`ζuwP4*O 4|/w[=VmhǤ 9D~Ԓz&M<#i5¿-~ɺ ~Y yt,9#RDħj0V{+6~֍F-vzN=Ds|Q=?󁿛wZO7nWbҲZAKPӦn(C ŸW Jo{4d6={J$A W1błE;&NSsퟑ0[Ⱦd.pXaPԒ'$Ua6vd31ê,s)0Hz|Yپva@sO*Hr>3CrM]O~,?q'sx6@Ct"^,yumB?;? pB|ѧcm$8Sb#gVg^ r&X^Cj^rO_}ȿ~K4՗Ɦ5 Lu?gae5'G> ځ Ym:}]?ZevhlRk}&dY `?h ^bT4X$% ;PHCr/>g;Wf]vlUٱWgqsz4 7hG҉V3/fCof#!,gLeft!qN.crUw*MU*CУmTKṡ<[&]9ǒryIvye<4=i3ͬo7mo>LU>AV姫i@qݳXC/=luϓ_t\4?ȓ-Jƺv" y{Avٝ`Xb}T`E|y#z(gNg|!8iX-t@ %Ir>V lVI|f8DDrd0ٻ6*?<csD.{G?CQ  zqkYs{p>/h?|Uk8W+5>Sԓ}xYGs(_m?]wQ._2$j ? msѿ?tga}۶}Fws'CMT?9bОo1v Cn旧[v|ȣku˧__cvQ+z#pEq򑗠_on#9" W/whMg浟qyU2y_^c%rs|3bόO,?7Z`r]ܽzg'9ZgCƣ{aRg?Rk6'OZ_oCglxlu?ik7ܖMȮ^=jψ^Xdܿ*M]*OuRx}/{?0wy9>hzuWg˿_&~I~l~aE򽶣Jj1xm 82dxU%, ƠnU=%ݓ_Ve〛na͐B6ryZ_& |i^fּT.'FFuy-"/ .!ɇ!< 1|f -7ggd wHjZ~MAMqkojr/w{12>@w 9|ymDc߹vx4<ܟ:hݛvlUٱWf]??7|b׾iwe Hp ٠d_R$ {QKU=Q<}? _ ;_Hr8̓B%*?woo[ۖ˞a 7eeP[G8)+ = GڿWPgh?~Ȯ}ҵm+]5mR4ĶZqo2V> &q剌0A{!!`[J]Rӿ2|Ku pM3xBq_{ܞӜDO>gjs9gCy]OY<`|L 휿oa;f ~}"ps__bo=ߥ:/磬_R90afcwW3:>p|u4f?& 7igv?mg||><ߥ/^y}=EM{[&n-?ߌ<޸9~܌f]_?+?}%L]}ߤ^>qzU42I}s~lKm7G~@KwrAm`I+ vݍ6݉ڎK\yz7!>xၜu MyR/?'1,WܗFe*PwU!T.PUZ|z|]7 <"d@p]Ƈ0C4y/2zgۼgE8'j?^tƋ:-<=>Wo_=/ :_Om>;չWgs^O^/ҞQT<* }e- W_oLZ}i8?ǯ1l;9))yfOK{{V1(@;Rgv{/>㟴xDLNlA~]61|߫o\=q~RZy?M>8nPP\^IYn+v'~;6跮t7;6*G_}ȴSMxlu}tb͊?ثbϹmz^|S؟ܟ-nO<-͊<85(<T⹇QQoR 4ηNpi2ʌbw49}A<,u#!,EFop(ɭA܄U͜655$57?8oa!Ńr3Aj刡Oy \016u=?꜖Z%GRξIՇla KECYYI*Hw_LtڜXF_6 7TsZO0g˾nӡXyGz4J;@&9UTfV[Ge9cbLO1#1RW fdռCsoX_h(<wCPΉ.vS(0i:ןu(.uvh *N. ,~) {1xG̺垨|yWK ˂r1Ęc8Fb,;< @ͨɫy{M|)<ޱukQ+Lx 0;?4#R]qn ?jQ`u>Q u]^ chU\?{jXWW9Ng2'\B0A8fNħ &;k+yT:H8:Az#%Dr*E<OO 4PkD"jrjB:FU}#`ԌZC4OOV]|3n&ǔ?(qT3s͊6*ثb͊6*O'_?!]ɚhv7.uy.nd[5[7..rVz};>-Lg8QD)G᪾N>ZDā\lg%?.!Grq7R)ffTqyr+G{_sj dyp89ov#qoݼQ,QW88*ø 3 D"ݟ+?$|w?y^\{BJkH_mc:Jcf4'=_+i;Gi02䀉܎>R&6:/dOQ9@gEVsثbϟߟ_j~Qjw7V㲻KIj5ܿ"$-I=cm;qOY'.(۞{n>ѐf;vy+Ϟjǘ-l|4;/ђ@S7E(9[ڹˏ.IqOQ0 n Μ#2jLqkY_//r|PX2h*DP0Њ45Z92f&$En\z[.xDϽAOqq_qwSY~a[S>pњ+S'rG(%Mw'~OX ˌKWU ;>h3idCs9 8YժhhxмfcupRF;ReKϯxO>wvYٙ3f9_g-2|ƅnH3" Hl7=j+r4:|#" G.z8W=WOOϯ˿W,mqo{um$wA$R"A{?N>1ƨsyd#!{]QOx=טu۝=;I/j'xBαPĐ:j#g#B7]sCUm읟/:?!?>7>{biQl{x.dbYYlf؝Xtl#LIcn}D\}'kEѧ6<1^!ѯt Ik qsr&b؀jGyogD@2"[ tvx刬sF扽g>g@4[KIsu:sV !EPrK'|xz L 7V6Mb5LڟH[ 8  Uּ0]\j[Z܋o&&~*#%e`wRqOe@F|xrCPI }: &]?$yòk>]ߝ +~bycEge<zpNW *b~ӭ={(>>ϧ8QYcxG. )LAyjkDq^hK 1qsǻBZig҉Ge˩9۹80>~yR~}:yߜQZk+mfY.LbJ?T5~c>ȏgj*&8 l`z-.w|OMS^"/?'?ܟSDDIZ oT::i_eguI99M0DxlPUx|Ͼ|_yUO˯2߻Mzu3T!Wf&cԓ585񍄮D{D2(~'i/fjA]Q叛[nLj& u:_MJNWu77 Ϥ>3S?2< /w䦕>=Z\:οtRuߕGz$^_yS>yvz}.<>=KD:hbϞSֵ:Y~m$i tJR2o#ݔ0cDd੩Qjsb7Si#Ak;&9 ?&E.$?>/,"ƕ4HlƧ%ƪm Ss@lΨ)fǴyxs;?ÿR^.n= w8857ylt_P;]7KAadCVJ%ڜS#K<e9^gs}Hs0j~&Iq|6Vg 絛vxr[qr=.ʺGmF[-hgvd1raDfQƋ=Wlq>Yg@]Dm@ggSfԚ [ ߕߓ>]3y'D|kq )rPq S4^vfvsbɏ4 8vq-Z#C˂< rq󐟗ߙF9ygʾKt1 FmJG іbG_kqQ{%ycɓ69GQ ud0 a "F;<(~}=k~^5Hze%"')]w}6(ɌKBQd?I8z>Ϧylsx[)<8/(6K2Zs\CeYbzhY^9;=[w3if}5Dnyt+42x:g]5=?2iu(]vOGKeT1$:xDF\뫽nf;'g4r\~z\Z1ʖϩ*"cc$E_"=hI^3N 6 9ch1=ߗ-5+ԼF*LWf&g,>Q4>CK/zڏ .ikƹ=)]* ӷ-$گoMÖSQ\j}ˏ vnhೖCYeQmŖFdw:gUQ*(T @p۞^vqo+~|yhylKY g2f]V"ЎٟhvDO0~@ЏGQ 6 3.>÷l)yJ'f:W_ @hʑ:/]gFZbcܐ?/ǰ o!]~_Yqk~jXwyפ!I =l;G9g8 c>|.OLJp,D<ߚhŋbɺDޭG8#VGBShYZr#=7ţ:Q~JɎ,˕L]vHC4Cjm!1./ \=IfUz75|y̶P=hFgYIÖeME" ړ=9G2 u_U@w8#1ӶNS"h//xV^fC;Sz)'ibê \DFu9U(d8g?{1|}2]X?t;ɝᴑ5rSAOC۞tLb\C]g(\H9_<-͊6*a ssg *~\\Gu4\|ש[=@YaB}`KK˶\?Ow#Ѳ0ia-d9G]]x[vlUοe_?qsOi2_i|>럝]vثbϹmz^|S؟ܟ-nO<-͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*_[65>^ vIf`F7!yHʀmLqƀr{ |ur>u:}G999,yGIKQ[,\^$b>ɑWs}X/<K 3QqVM nG֢Hu\E}Z wsTw2k]kRAT(D-, 9ꜳ?]=L{sHHo"~UNDN|{cN?,oȏ%SPo1Hfz3L jTr6Djk=]7hq6G6~ byG5vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWf]vlUٱWgG ஑m(]n>mJRSK ;,$o12y^3|3b͊6*ثb͊6*ثb͊6*ثb͊6*瞛 aTW"+'x~]s/ٌG!w_HjS+]]~LyjZ2M6<[3ͩԞOXHps.qc! { &=qb}Ǯz+91ثb$u*iۏ~w0M%?jK\gO6*ثثbϹmz^|S؟ܟ-nO<-͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*izn_hŅjp]F<2/*Ђ2`c( Qw?"jz_OA&[[FO AqOM_`bQ~!Rҋv4 #w/&\:_p4_NKmp_rrSgf&c]$6.i5Q{U8:|Mok}N3βŧ3eJցZ/96|'M 6 s1F}$^NN-$c.))w:r͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ث+Et>d64Yuhn)㑒B>8hGhJdxc>*<5~nϕ_?_>s"(TԒē]>,4m.QwI6I7'lsNl3şzA~s\W|cmihVrg39w^KMڍ?PGtގ I5@4sՏ3N&@;Gw%;?&|s@C<-͊6*ثʿ柝 ?"Oe7_ڿ}?;/͊6*ثbUF_f?KQo4_,Z^ͬ>my4h-U-'u &=QH0@_~ri*{m\S/ϟ|H31C?y?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[S/ϟ|H11CnweRS?f;W?h5[n3L>U jLcMy?Fo)JC Oɘ\To7t~GE2WS34?-q_?*5?c&csS_#7_!yLv?k?#f~|ԫ?@)UMwG[_󜿛^@.<)X~b׮K讗PG w~f62JQ1DB'^m:˞uJg]kyWf]ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثb͊6*ثnM~|ڲBONPNG  IHDRombPLTE.[/Ho@@ M"D*5kvatT,N ff(Lb-F-P33 +U~~PP+=wZnz3ff ;e=Tyk9Vm{,F+@")0+Cpp+-V|+Ey*8BR{o,H.Xk}\ > a,K*;/(Pk{/Hp)3Ki!OtRNS=VbKGDHgIFg>U cmPPJCmp0712Hs~IDATx^kw銴)%&4ITW9G4-Q$)n{;v;~mqy,0F,_`#t@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( z}P|>Jq=?䖾[CntM?PK"t_yrQb}K.}Sd~_:G_̎?$ZS=j {XgOP++0)}%oyVt}3FkU\To>g1h@Ϭ WaB3{8ۅWy>dӣSuG ZlmB'puGήt6zˠ:G_9t ̫ c{8n)#?sO^O+KY\t}a, +(l }b9bcn$ļU.\"^j3H5ިg!C"[bЧpj4:(ywWUcjQr A:7ZөQ,g(1槂t} K,&Za9@m U;{SNJn{mC%K:CPz3-S®jUzͽaM{nmag%o`w {7.C߻t|OΫ"';) }*~:AsoR/M񠑲`0tˑ D>tckY7ftR]&ru=l>taoBwvo$;nЍgv(o9tk |27%JL7EʏM9>}4I=1X87X+tE{gI=Y%/Վ ڣQn;#݅Ti3F}DAȼWhtảQ<sölƳuqznkV▂}:B cNEiz+L= q۲g2߲;}d8]9y9u?c ŦѨtt_0;cK:F$}t|4*=rbW6cj"FU裋6It}]6f5U63{YYй5;\c?ب@=\&|?ǥ lA?T̍I" Qy;K $J%NoAW!t3G{VG?-Ӫ[:f'ʑa"2zgfUb*^+u>j}e'Uo5s2![?ո/&5,dWutƒ75_62H0IyOqr8UBJ7'|TAO ;_( 換S^.xyiX# (QU֋7Dޏ4Q11l7I{zj՝DWlB~qľ\@m^Б7\->R y2^ÐA_m$EF; =Y;#t&τ7mxSIlьx+|r͔7{yWCw6r q{>NOO_ mV\r.|z_ûoWLd-V]T{=utT(Ʉ.Lʗ;˖@xXD oNvMbLM {{"{?Kth:Os@{ǥ5#ԇ.;tZ oһVK063$Si1&>At<4 ?~>ku8m&rSJ:=:> etf ܖH"/ݿ>뛂քΊ1Ln?=G6[<؅`p{WJ" IރU':v6עu^~6f=tu֞)%E>'!CIRO{xsh{]bd?e>ZDcmH] 5^#V{rP--%D,iWW.~:7Ӎp"Cp-&Wf?/+_y8BHqnU6:N/:U7'+}-D]K]K+$nC6\-z"9mi%R]ҙ{ s_>}(L]-ҙ7gtO `H9WͫjzGQPי{Imx襠P.ꬢ+ozc t6r^њө[.U'V:Ǭ:8]x~oJPrޢ)Ӏ `W2K>w} mƺqM׾*}dNI}qi"v}62lLNl❆.dI}UzйْGч3|EUX-Upy.jzt&p;@˩.Und眾@"ǻs&un29^f&5@B50y_5'x\o8yx,_vSRz=j8>|5Ez(ݠQhz<:߲:/1%qW%~ϡ4=QP(u :}+bNv(u1cS/=;S!O&3):<I RN9gHx0.jj~86_=;a&[?R6mi;أ = }Ϻl5:琓s)wEN^mGη6@`BݹA=t-7.u}]udߗ\$r#]{ ٨-q0AfB a(Wagyϑ#'7gC0oOפϡ\rscv.RuEn:^;lf$ʼn~Jhzvvv6c^7[r[8*r9 "WLaXA=Dֻb$x5B%f3Qx@WF t@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:At@'&CNM :A4Jt h2=@d( zP:AxIENDB`n^hCHF= ڍ%wJPNG  IHDRz -oKPLTEf3̙f3f3ffffff3f3333f333f3f3̙f3̙̙̙̙f̙3̙ffffff3f3333f333f3̙f3̙̙f3̙f3ff̙ffff3f33̙33f333̙f3ffffff3ffff̙fff3fffffff3ffffffffffff3fff3f3f3f3ff33f3ffffff3f3333f333333̙3f3333333f3333f3f3f3ff3f33f33333333f333333333f333f3̙f3f3ffffff3f3333f333f34N)/X4GImBZAh}h퐩nLtRNSS%bKGDH cmPPJCmp0712HscIDATx^۸},Yl$ aCe[eQ IzqBN'9I+!q                                                                                                                                                                                                                                                                  @ qa>s_!sB<ӈCN1ip{9NAF aǽaZs3cbRctsJ|i{|))'8sܧ;M0 @3x;}>TL` y>U=5Uꏓm__Ҝq2ѡkӸ 8qseTO`b܇]3|Wϟn7hiо i*: |/vy.h :V>>i>'ZC9铞Йm[3CZ$vx1-b{x|{k$i"֤ |[9~|FLJg}M@!إg<'7iy< c/w#9!?|BOsSZ6vcA GPPBO7xN[ ^l:2"V]Cڂm]lR׳վ191 @`T=WM+i|z5f}F &u;m֮MØP]3&l1%= UP\...-(i.7Ϊs#๞=czf'mStax©x]?7Χ= 4SH9 ^Ϻ!CrYmcZ_^Y&  y=Oox;:|c!Lzc=OM/@q? @=E򚂟1o @=kRUӐVX& z;I۴=ܹ# ,p[=ic?r7pVwOeq5& zrezsLkކn9uI/!ˤ%!Ƈ5m ->M@K~qۜ1捁UO^@cZV0 C?O 8_F@'N{LSzG"A'@=y:;Sm??Kd6lB"Q N9Sg4 atg pggI{۝ԒdP)z\[@G/EtF) 9al#q @w)l6yW@,f_l%e:u>x­L/jxy5²CN4P,;Q,N@ӱ7Z*wƴ_/>DzO=9aڥ=^ G @}J0|ai!'*y߿[y(G@ճ'e^}17@9U=x8&$UU1GР3 @=snG p1Գj9j;m]s~VOzV)-pt\Y=߇Cxg 9?V1# ^~8Ovci$ Y|NxCo"gI;Uw;U*]gUPR<遞]یU3y9ƜF\gU98G^wuPUϚw\izd1@ 5g”VͶU14g ꙧ9ކy xA=1 ^`P=&eiz`lюP=qm=ל P3y3G:TEzzVOz=ϗ!T54g =j"@=='eSpW55 zӳzvivW9 PY=alixkLiUF@ӳ{y@zzV<G PO81;T84 Gp{8<{ G*$@=]'8χS$­G?zG: zztv1LS*Ph0co,6@Rs;o%tiӣx^azgP$9OI^?1a ^OOI aF zzrp,1yiPOOǰcsuԳC/:C3GK > POW >n?_U TNzP6|KN@A=3FA؇^R7ztZӍzN;޹cP#@#_>ԓf?wh@Ӈz{qd&"t"Tq%@@Ӄ|NۆoFP ԇi`͈FFzz8@1 -='LC M UOieVƜv" tŌ4C@Ӄ{~͌9 EUOI+__?:D@Ӷ{iZ[FA;4i°nPGPO6N5"owMN[@zZVO]^izmVB@e]:zZ*@POa[tOjDŽ%F<iY=!ðY٫>fqu8yú^%󆇣@ iY=pq=mgLyL\Ӳzc=^m8Z"Ӳzn=gϳYᶢd-ճښUy@1Ӳzݿ.wF:rd3`F: ¡!@=-կeJ.'{UrJ5e\V?%#j"@=m'NðxП˟A- @=-6//}5韛䧿a#@MEau৵jtڂӢzNĞ3c#@MELq ]N!RӠDžOY2@&Ӣz~㱿,< aJ2@&ӔzoӤO^^MN[@zZRwSis uǶ&]WEr7ktڂӜzN^c- PiP=鮦k(-2?ud^#ԓf?w^׋Vx]?t.ewӖz[Ͼ?Ud}GPOSI1{Yc_Y2ktڂӒzvq?ܑ>a>й]oe}vs|[fӇ1\^POSaa#<~e}C̷t͒@U/pld/ˀ @=-g .?fAJ/z"@=-'|~`YƩi>3֗-3t6nu POS 9Xǩ#iI=ǹm29'JgVwhm; 27mG?ӒzھӳD #Z&@=-᷆Q t:$@= 'm)ñK4LzROhm gc@ aM odp laҥNPO ]YXr~Nƫn iA=-=u5UCVl:%@=-gٷ_,xdWh!~htel:%@=-gӾWebC;@"%tJzZPChE=9XNǯn!(iA=1s;,j`OFSӂznkW`,=Az@ŢgYyEx  v-.2sG7865 PO 9LKsa {_`&@=-'o[j (9#@=-g7oʪi"7iA=SsWan`&@=5'mhn}Ȏ(9#@=UgΡ٦X<@s#Sԭ19V,.]bC9Sza|Q,tMzjVۦ影@Ħj,ՓOcm-G"Z=sja (B45*5 POm[ hc-!V'@=5'xww-]KhDj+זV"1z@KfL<|-AZڊ@f0L-ͷ21z@KfajH=XH"?Y=q)fY'hԬv ̷QRQ*POV.åQ(N+uՓv3he2 ᬗBzjV>7r%-RqԬ)uh)c,w%Y7hԬڧۼ|!@=5ggXՌhE Szb#[rjPO}nB\"R+X Y=SKbk@f&V/(rZZPOrX0r ĭP0z"Y=-kA_,Ԭn,3PO[zJb- FmD`=Fcz?i/LXR%cgH)-ӱ[=%mh6"Sz44pgQ= !@zTOS=%el6"Sz1|2] Yj "@=5' sz7v/LX0)mUZgTc5:3(] íl\.3cXޡM­+㺎@zrYEc>"@=k(cO P=\Kp" qՊ=S)foC|TIMB^޹yvy g?ůy}îY5%R1U=*s:w!x86x7cqʻ^vKy\_YsT6abnnqUv<9͟)f;yʼތalhf_U= ']GSldl8>S1C#rڍ1x-{N6[UOe]z.Rw҄[],n]ou˱n񗨧Y;Ӂ{.nSOMP)r*POA碸1)rʨDŽ[.UO?8ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD)Z J=EN%PdXd^$U]-(AO=ԓ;;H"STRPO@ERՂROC=YD1_gXඉR J=ESd%ϦL=ERK7AȩYzC;znROSI=Գ^Hj&(9C=+VO0p+Z J=EN%Pz86 7}HrP)rzgӉiTm,~pD$+"'z'+y(ܳm-zJ/\ :0\vB=EPOzn44Ĵ-Dn 5zTO*Z$.Gpr"'z'/w~|hY=8?znROSI=ԓ0sHj&(9C=yi9\ nROSI=ԓ~"S\R䪧{=S}lS$tzJꡞ<<@> fOEN=E0SW=s<KmquLw~P9˝mW=yS$ӝzgG=? @=yɳmy_h)J=糣2 ߖՓ&܆9o)* J=ENFf޹y^U yy 0Lz.9Z-)r2PO+ܦ9[n h­H;?(΄ 7nD`-nH;?(ώzz@C+{]ItA'^c̈́[nPHJ=? D R/&܊dRLp+GiQItA'^c̈́[nCHJ=DŽ$'3fMtٙp3V쯏sz2ez"s>;CG)Wz J=Efl{=|'z)2RObR40ϱ HJ=2 wk"S$ӝzg^{=hyA2OmmHJ=n&pS$e xc̈́ۿYXMtٙp3V쯏'ܦ[)2RObyDŽ 'pWn )J=SzrՓv~GSOLw~P9P}oLItA'^c̈́[n]%3H;?(Nգ)GnaoHJ=U'T "y.'(>4s|iY=smoNu&܊dRLp+V6=P*)2RObyDŽgo/UO<zrpLj+\ep&Eg30zgq[RO.\r?n̈́[nP뭞TX\]$՝zFWO^ꡞ3Wηl}.\r&L 8T[X\]$՝zFW0zT=MV=ߖ|J.9xAv>U=5EK8C̠H;7(K΄ ok9]vsw-2= LJzT=kzGf:"ܠs.9UG;.2yH;;(`ޱ2/ Go!Aէ"Sdp3ᖗIۻ3ӉظS$e xPꡞg?n6)MEg3YfcԳpX"WERAltG=TçyVIugQ@kKz'JSc?"ܠs.wp­nSks!"ܠs.9!npcռAzt ].LpXfP򯏖&bo}]OS3ꂞIzG=C=CoَqNOEpDŽz& @?%ކ!=xTd z&9GգF`ŪWVzf)J=gсUO- ӻ7y-}CڶzRG'/6WVߤm.ltC=? YYEϯtǧ"SddzGJ+_ޖVp(2=NգQ|蹹KO "ܠs.qg=z*_vsnKsRϹ'W=i?c)O=7qr"CC=y{6No"o^ޡzIE"z'/~}Ksɠqcݻ0)]/zo1zzKsi_CU_!=3>tszAꡞz'+V]<^'|~ I\d Iz2Rm90vs?S)rNT=ӳz5"#\\ԓKX='ܚ(zn)ⲃRO6? @=ӳzNn.^EEr\nP%CԓZ^fpZX} ty[Bzr R,_VOXvszܠԓKzgeه8ߕS$\C=+SO]#mi/jJ=Eΐe{4dXvzt8fL|8POq궛7Ρ>"'z_/ZnzܠԓKнzVvg?6~)2%@=zVuՏO&ܠԓKzg%8̇ݧY 7+ܲ\r#)]+_7®4d?&@=gpx΍nڛp+rRO.An&2ᶋ Im43&T=U=!Snfo{-OGzꡞm!MMqA' 7nOyeھ~?Ǵ 2"9.7(\=1L8b|gnEr\nP%H=ӹz}0nfէx80fL|{=d.U\%׶nV8F+rRO.AU'ĸv߭)HJ=;77ϋAU=T=6OٳiiGq=sɁߢ'/p~ԓezלy1-Lwlꡞ~3Ӷmmif)ⲃRO6BnDzWpz=͓VTLzUt}i 4g۾Hn[*(,EwqzWe"mԳJn&+|Rz괾`<~.0LSG?687cs 7 ڂ.Dz0p*}5zy[=ERbAg1k#,$hzMq<vǴGJq=7ɨ~拪UO{U|ؼjxbNy$+|z@JWp æEO8cDi̶\PYb˛Lp+rYلC8-499UO;U~OmmyNEOz4ɧ~SQi9ިv䴥RDQLJ_r&/-l0voohxPYz p^ C[|8mȧ~SpSS &<޸9EC=ͨgc}j,ixPY 7nLgIŃRHzVO !sHᡟ Y)ӖJ=K}g̈́[nwq.6ο~݇5POD=Szi>y.տݥ5Iiőc-v_GJAx-KߧtZ?)rT=\T=a7NMGo>ʂ"@=ERԣTq _8~mA?7(i\V*(!K=Sz͏i8=.3eROC=g]8By8ԧ%SlQԣ)鶞+ӝw tRAYꡞzԓl>A;! eA "`z*ROڟ ~'mE2YS-P3q؇!=>uϿJEPOC=WO tccګu{wՔ~n nIełROC=Y);c#+mzr41gھQL16H.+z깂zNeOOOseⰒy;&zOOTV,(AK=s n_ iP)z:Wytg=QS$ J=ER\^=KzG/ CZE)rzWRzηᴜ8=2wqbzGwE POC=%3 C͐Ny3!q}C!,haS0POV&nT 0Om7^m~[4?oӦ >"zgA|X2:iA'ۥݨӌ+$ ~R3/>{٫gX͋y==%Q&~u,H昖Ɍ&@= @״O#O!r~}Zld]}g \6cz141PS ptzh2j4,6Bx9}SǴ4"XK mZvNڢwNG]bbШt5z.2N,I.ػzB]z9OT=v@6?ׁLzjTڃF` rvz#@mmTi~ڴ}0Goit]s㩧A Mo |.ħac$#@KzTOA_R>YPli_<6iii+feOQ 7w )mfi(܍5ݥ1@w_cm&2y`xGԳ `.E=:D`nC3OQ~8@#^~1D=Ff"ro?ѽYP}ue s! lvq7/"&V>u&lN!eQON#X7_?E⦆uhGo6i2;C=- ]ǝ!n/_-Kz= }5}޵JS8Lv4ԧCԳ摭L~<z2ǝ!r īWnGVx>6};O= SMD3oS+&@=} jAziaX<~j }xIO 롞.mAj ü ѭUGS0z${ʥ8 * }](POSwSQE@ /#p.pc­AJkqNk|pׁ_TEfC >zT5>5> ܽM a[} >^!Pi}A6T `A]#TkO0l8B[C]QRꡞzƥ 786UO^*lMcHHH{ OsՁ1m0;!P !S=xqKf+ܨzz@l8.aޛppqEV6? @=} xAo/ja4j+!-* P$&"rs.=H$@=~UxBڝ:mSb$W&pyvy[!z<< ~Sǰny~D:R^"PoyܰmQu~xj y( T=+"[yBogq'&r3~v=Գ,@6yJY` [ZzX'6_ii&@=z@_7_CiK5Yv3}E`=Z&ǒGC%gP4}6gH{ |CLk҂j9#:ng>!Roӳ!9g9Dim^x検}Rp2ꏢ@`74n^5f}F' ;>,Dz~r:#p^%>V<,zzVGt"8ҒUudF/#.i-)oO YW&[Nga!mfm+Z>RMX _^a܇ֶ?ıYK"O~ۻmzh4=?im_3yWUOF_E`n7@Au$Dަ)-t`Zkow?a"_n>ގodQS0 M=>$} lw6N/NҹM PtTta?MMczB1ms|(Gz%VLͫnx{ryWd Vut}=-fNqӿ Tر H` HHEh~Ht[qS>}ZR!lTvDJd[Ymx·0qN |$y_/!LپRϵ ;n}PX7ݽz׹Ҫa.9* kHwzg=IHOWEo4)CzJtu>-`K=*{{L*l޼yn޽zHSqiwTt)-VHW#pLVwo޼~n?zxT'Ƥ!94ݥw|۬ =6X pM> P1?=~}!m ~X^D- 7J@@@@@`i06ҐC@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@g (ӫ1IENDB`@=eA4~p-*jqv3x[lE9=ri0 AV(!A !K mh1$HS H r > *PkR rKx }=s.%nfvwvvfg Iӝ9BK|8*?ů ړN,!B{X$MUT,b#*8}L$ 1 yp09M E̦)0<~!VWECO]˴-0zaE2ɣUoi㟀L7s:g =FFQy^ &Ԙ~M|XL3NZF\"r ֋ɨZKhk!oW8oplP[3E<ܧ/N#lc(Z7ӚL4C$.'.&yUs|%A%;icǪ6VmݜYRXQFsd4$mrv? hEs̽q?w=MjLFxc28rGPKu/Kk$/z}I#Dߑ)r{G5FjrhQ՛qTc5*O{}_-D#{($^c֯A̷݃] ݠܫ̽6eqM":?I2 %9.n@ Q Avp\YE+On$ȭ<7֊VsDErc yԯ > 2"Z{Gf{cxMz&c<j/{.]CnUBv!)kuDk/ܯ?R㽏hE&xWɓǾ ȍr+ĵf\(1)9NY%Z{ɍ=~3yw |Z l |.FFYk#ZZu| -oFvЇFـƻ@NSMYk oF=6Ej26#urvd|)rBΉHu7. z[mf6Ny;⭓:QIIesvr9N[,󝄛'ŵӽ5v[oySnb)i%ȵ[|F.Qw7S SNUiV\bhwO湿 oY rm],ZyFJc*6Y\>|.a>Ke|2ȍVr+IE rz#MnKF.HQ>X rz yc/籓-m,=e+V\+%Z{Of,32O=޺[Jy&3+ˉé <;mB숵q\6H3׾u<6P[T/!ŅFVeM$ x`./JFIF,,C    #%$""!&+7/&)4)!"0A149;>>>%.DIC;C  ;("(;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; z" }!1AQa"q2#BR$3br %&'()*456789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz w!1AQaq"2B #3Rbr $4%&'()*56789:CDEFGHIJSTUVWXYZcdefghijstuvwxyz ?j( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (Vfo^w". C5͈m%c)¥I]?_/NO±(>yw>_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍LCA9? ?2+9>E#o/NOLCA9? Ģyw}?_/NO±(]_r62(?_J(p܍`jmƇRo? X4Sq}S>#{Hߘ?7(p}F&#14o? X4Q>L?܍MGA#~ch??&h}G $M`G<0?r77Hߘya~oo? G&#15ETϸ??&MGA#~ck9>q^; l `  ܮo?)[z "i++((((((((((((((((((((((((((((((((((((((((((((((((+?/k+?/k>!$ 4QEqTQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEz׀R}#]%s ?s'WOG ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( wC}K wC}K쏡?BQ\GQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@+ [8 iߟ?ֶ+Շ1NQEQQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEC5C5ˉC~( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (=ëzh?c?*`Ҭ#8qWWz~l(faEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^Q3^^Q3\9'Q+((((((((((((((((((((((((((((((((((((((((((((((((((((8 [Hpu QIsvF0:+?5 ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( wC}K wC}K쏡?BQ\GQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@jxf?8V4^g7 T1R9y?(S󰢊((((((((((((((((((((((((((((((((((((((((((((((((?Կp?Կ\N(E}PQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEW[6o[6Z䫼_ffcPqAZW<\I/͞EW| QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEW_ ׸W_ .'d}CIh>((((((((((((((((((((((((((((((((((((((((((((((((((((+>CD g@Q&νs%jH+Χ˅v訢>4((((((((((((((((((((((((((((((((((((((((((((((((+?/k+?/k>!$ 4QEqTQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEZV07Kt xp@2Ȩ 퓊Ptv|}=!V-Q]Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@x~!G{x~!GrvG?ğF(#ꂊ((((((((((((((((((((((((((((((((((((((((((((((((((((  FA!e f0ml\`m 5߇VϏ͉Q삊( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( wC}K wC}K쏡?BQ\GQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@-9y>?5w5Rp!O+N9OihQEhqQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@x~!G{}xAAB5ˉC~( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ,TdC{;3f x1Tһ&7\=>l{T,1* U(Y6Š(AEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( Zٮ6G=r5W6tI@kr1ɭhnkW%; Z(H`((((((((((((((((((((((((((((((((((((((((((((((((( 3}_Fʼ7W|I쏢~9"Q\gԅQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@{_,+f]Myduf.,0'/Sf@U  Gv|}WHS_QEv0QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEếoO׹W?#\Y?DS+(((((((((((((((((((((((((((((((((((((((((((((((((((qczK[X ~A{I^ѣAyi (<((((((((((((((((((((((((((((((((((((((((((((((((( 3}_Fʼ7W|I쏢~9"Q\gԅQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@*;PKsI[^|Kim0U݌ToUӴ[0su8QEzYJNRr{)QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEếoO׹W?#\Y?DS+((((((((((((((((((((((((((((((((((((((((((((((((((@eaXH9??hƟKb}?κ0ܘnEEWyEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (5<7jxԮP899״?gz!+kFύΫ{LG"?QExEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ھ"cF$W~4һ**psS<3e~،>skZp)kJU&M (EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( oggq:3yqq߯<'d50U .42>\=tay_u(*ky~HEWyEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (:_۵v<W;}(q-_zʺ:hǖfxomlAEVǚQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEếoO׹W?#\Y?DS+((((((((((((((((((((((((((((((((((((((((((((((((?gX-0LeHq(Y ڤ7vGp'V$,~#yMo;eT()h3B((((((((((((((((((((((((((((((((((((((((((((((((((((7W|I*_C7'k>!tQEqRQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEOcg. #2LGǿֽ;(m!\}Ks6*bY_ֽo*KhaEWIQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@xn!B5UếoO&'d}C袊>((((((((((((((((((((((((((((((((((((((((((((((()̐7<G!tQEqRQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE:8YV(ԳUI={V.[YW2V<mQs B?z}veϕ\T#Q]GQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@xn!B5UếoO&'d}C袊>(((((((((((((((((((((((((((((((((((((((((((((()D̐ĻF Ԟ>Yv,^O?T#+ҕGt)4m" %d\c֍WJs-QE ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( _C7'kܫu ğLN,㟢)E}HQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE5בZ۩ie`1+6-'Lĸ'ǹs N)8տ]wae#Oc+((((((((((((((((((((((((((((((((((((((((((((((((((((((7W|I*_C7'k>!tQEqRQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE{EuHl9vsTk|gin@ʧoϭiJÏ,5.DtYm % +> QE((((((((((((((((((((((((((((((((((((((((((((((((((((((+u ğr 3}_F1;#~EW!EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEyHRTw&v/yzs迍z 詡ڌ+cZ҇$|υ̱YuŠ(8(((((((((((((((((((((((((((((((((((((((((((((((((((((((+u ğr 3}_F1;#~EW!EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP]sfx\o\YuV;DȏJW^oopB#BWM w|sgO$QEw$QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEếoO׹W?#\Y?DS+(((((((((((((((((((((((((((((((((((((((((((TiQ1dI]<7.LQ!SMP|N"8zNuZX(Ti:z/[Q^bVUf=QEFAEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( $0yUݵftIuQ-0~i e;xT,q(UQ Ɓ8Sp4;OhZ|Fg[G[QEQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@xn!B5UếoO&'d}C袊>((((((((((((((((((((((((((((((((((((((((((+|᯳5S$ FvW? n d}zP0B|q_WBE|QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEW?#^^f$ЍrbvGd?N(3B(((((((((((((((((((((((((((((((((((((((((Dޥw={\$FdF :^GiV ֕>wyن5ai=Ӵ4lqzEc'&(b ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( _C7'kܫu ğLN,㟢)E}HQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEv𩻕5k‡w>P98a麓5a5;؏ڤFk**aEVQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEếoO׹W?#\Y?DS+(((((((((((((((((((((((((((((((((((((|0q2 GRhk,jMzυ|/iJK$t{:M*{(y*OQ]'QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEếoO׹W?#\Y?DS+((((((((((((((((((((((((((((((((((((tq,qwcP2I8i8л¨$רxC Ʒz}hHooT=QY]hޑyg/Fz?0+(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((7W|I*_C7'k>!tQEqRQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQR[wp[K!ªII])'bݎTdxA4CްuOKOE -{ 붍_z['fw(<(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((( 3}_Fʼ7W|I쏢~9"Q\gԅQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@U3LR-7SG= _D)IE9I"+;;z)&o\|cզj0$aɈ從]^f9zGQEt QEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEW?#^^f$ЍrbvGd?N(3B(((((((((((((((((((((((((((((((((+^ץ6lKOZq3V`7dSzClPJGʃjC<95bO-4~j T5|f?1)#Š(,((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((+u ğr 3}_F1;#~EW!EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPE>(U$gv8 $ףx[dcUdrCc>pLV2z] MGmTI00 0▽SPVGqS`+C(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((+u ğr 3}_F1;#~EW!EPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPW4&XqnxU&|7 ui3nd#wkt*HprOv>rx{^g<'gſkt:{AߢTUj܊(fQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEếoO׹W?#\Y?DS+(((((((((((((((((((((((((((((+rʴ~C¯)۲&s"'dȱƌTd]޲t>𥎃eky!VvS>[Jw ~DX*(U(Š((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((7W|I*_C7'k>!tQEqRQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEI U+E֮<(K9Wk<= ?aokNpc3 8Ug[<q|RTAtwWZY[+ITbSⱵqRޝQZaEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( (ږb3>^i۲3V7dc4YUFI>x{[.ubaT=h^Ӵ$ yq֭짇KY3Υ+†RK+k u5 =WQŠ(AEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( v2Mݵc*͆yY[h}Onh1BOo»:M[{8(tQ>!AYhx/v')|<>s/_(}TTPTt` uF*zsTw ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( _C7'kܫu ğLN,㟢)E}HQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQEQE I<;JUK3I5h5=܏@ỹ#ƻ^þnI+hQ+С}g xPv}8qvtNbgnnYik f:IvBREjpQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@xn!B5UếoO&'d}C袊>(((((((((((((((((((((2 G= n2Uf8 k>ed\ZEֻ#Z^e 1߷J%-r=k+h5IY+bJ0>sb17e KEQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@xn!B5UếoO&'d}C袊>(((((((((((((((((((rp95/Zo#sp:Qrέjt5Gd`U *T˲r:+Ѵ]/e8o3S6,PDco< EGdykժRMKEFAEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEP^f$Ѝ{xn!B5ɉEsE:(ϩ ( ( ( ( ( ( ( (vVv\H%qJQWCm_\ ,~'k_7{h_8) -=ZGEz}常8\(ZٴΉez3a8*gx)k ip|c?kgKuMzҢڪzZa՜3گ_ D}SOV < Nųt+TGW1UZ~DPAl 8 Eʤ8oVQE ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( _C7'kks\p!rn2N}+ ДұeXXiI{aEzW+-3?_W7{N<֊Vz?iᶈ5C"4}^bwqW@Li3O*e'o437aG/[V,xٌۤwJVs7%RisrqDBʽ+KhF"0;"RK c,i?Wg~fEJqPz?zk {]1_|7֜2kH| Ћ{yڨHנR*G<\H k+xzٷ.飳h8.$ؙ7->b"b9''vĥdQ@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@Q@|  LP #*VerdanaNormlVersion 2.43VerdanaBSGPPF{lgisw|zoA甥)'rӶ- Q0DyK www.interware.huyK 2http://www.interware.hu/0XDd&aKf  C 4Aiw_pont_color"@@bvWvtrr+rK&4FRW M nJWvtrr+rK&4FPNG  IHDRz -oKPLTEf3̙f3f3ffffff3f3333f333f3f3̙f3̙̙̙̙f̙3̙ffffff3f3333f333f3̙f3̙̙f3̙f3ff̙ffff3f33̙33f333̙f3ffffff3ffff̙fff3fffffff3ffffffffffff3fff3f3f3f3ff33f3ffffff3f3333f333333̙3f3333333f3333f3f3f3ff3f33f33333333f333333333f333f3̙f3f3ffffff3f3333f333f3)/mp-339=BPUDtRNSS%bKGDH cmPPJCmp0712HsRIDATx^ݍz66`A8m&|$R1A_vg㎓Hĝkg$Wx !C @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @U zBU M /ԥ7!v7!>|sBFix s䪑6q?}G}eMTL2?bO_[9>_ןs;xC Đ ȱyubgDKuyr,1nח;"tjOſ8]'@zbOw_m~\>t5yT+kM i?mj>}/={11YgPM  @ C8.?\gW'kmz P@oחWԞ\@^&f=t \M;+X./ˣ \./$?ŷoU3#T.V]9\DW_)9Ϫ'X,Q6->>ƴks:3՜ҳ_> P@&_W;nsxNΖW8\\^(=u2 LހM돯~'_G{rf=  gf{mvau9/"cړNS/S X6JYOU?Y'>of(p7w]oIIujmj<)=39e*[ݴwyߎ;?6w܅}2EsT mf(7)Hf6Km݄̏/)=39e*A~:4WMkVUu,3ǫV[k7׉awM{zftT'ߧ]h*wGWe q$gAgN@m)>OvGLW umހ-bhx-?÷7sZLGM*"ffK۫5y"_&,7ӻaxܯY6_S#@n?غ;wַ+;GLM 7iOK>Bvw~z·z_%zsXEv(= >.63"@fWSw':׉aӵ]n?? mLAh^ɖo>?*!/˾cqu m}$@`o݉)l\]^V\e}:5*Іfw{(= eSWS߯cwaUt LX>olo(=e8.2H) 穗 ztV,S >,'WLUu>lWlug҄P uqt&_g[ոُ n g;:!l>G~h>ZFO)=g:' TWǯkfui IkuȬgWgEJ<9g?ogOTڦO)uG)=S:/f,p[~@۩ 09C}ܜ-.w~M/i 0c渖-o Osu6 @;e'.=}zfvL]隻_6w;_՛wghG6yվu'T 0u}}Z_JΏm<*=3Q;E-}ccЧܦsvvLN~?ش) ڄ֠[/~{VչY~N }.;yQ]8\)GOܩ 05.OuRڧ.Lw|@~hԖ/o~YqmrGn}bwiSzt.,S`G]Mx^Zu,3X+O^Y{=@5LRLsjQz86y=AM趡 q6)Px,3( mc׾;f=(:D@It/C;JOߨX_~`屛↊ PN ]nQ2wj lC+:D@9• rP- 8e-ǟz7Xtg oİWW:6yX@{|NqA[ix;W/sH>!m\iX D.]A}<ڶ`Hx"[.tMz{x.<',OxX{~.Hbqu׶V䪓 T2t89LfH P>W"LVE5 qs|YqaxSwpqH3 R6)vmhNm)m<3cSEU ĘBWl9ZզT9 t16!6tפՅMB'Vxz Eh !uuog@*vL(=#@`,&7NX60p؅.|V;a6M݆.nl:? @`$?hh<)lF 0@^OMݦ^ OM|48 ䷐7O>zk?Ag1@ '5"z6geF?Pyh8muMdhmgfQx,3yt8E6's׿$y?M@c+qPSϩ)=G#@@~h!imu*zJm 0@w.UQzF(G@QmեΫXfPthέHgaÅ<3<."@`d7yXwzF&Giy5[H!pkP_o @]ίMam\5u.LH 6:}zk0NhP9~!S1gB>ZP=cqN~x3u.i9W >6͵/ܪIojZ nssΕ kf_xC ]>.ĻMíkm \lSzhO`yۜ|-taGPy,3ǰu/M]ئ>tYC`Mh7K@Ǡu/R6sYw'O`*qChۦOn<Pz2r9 /t<*ϯ9wN`*j[_'y~JT 0kMwy+OPzf=ܝ<._yJ3LW1u vgN`Bym[X>ӒO)=NR{TCzS}x3 LHǴ ZyjnNRynmt vgL`:}&/1Z`q `A`n_ʶ4O~{9Rf=sΗ617 Z[f=S΁bۆ9Jf=Θϑd@l.^Q/Pzf82 OҶŮ/};Kz953 ՅE/]s K`o,mS?N0w+7lm]cG'03>ڦ|$`3t Uuec'0; ݭʣx(`3 Q &-m;1w}ݬ猃ء Ryzf943 cG3`%0+&b խ$P@@w$R܇`QuՄ46_R &"f='L Qm iՈ0 RqY S)]&ELRzFH`q[q 3pF iՒ FH`N)}hRVyԋf=sJ`t\x%sW[f=d$0']Co YϜb] s^JC H ǻ(=3JJ`tk۶ tg$yԉ!zΕ*MG@{߅JJBg9$ ,Ѕ!RGzFG`&M~KGHg&A4 *߄3Pj֬g`"7GLg.Q< *Uy] :lڪZPg6QD (<Ʈ_8 bHyaʣ< +`30pFaKWۆ ^+=i"0&o*034pH!TsW5,/a( "$)7!!-C)Ăs 0@ ظm p~;)t7} I=0B,8C 4] `IĮ0zkD&_ӋgD@nk9#=7W*spplC ط1$L1w{=C|8#0I惃Lk6$L2wY`_)Ї.[I09g<86>$˪'Nz%pm.4lS;$zJ`Whvk•mNOM&J<mBXV}O@9O@8*R9qn (=f E !ocn>YV]{OJYA %lR^3씞@!ІxÛړM'.#`+/Ğx:=g0sĐscB T įM8a ^0uJ@Y# İWa "\lW=uv3$ 4J`4 aef&`3ZF8Aڰ,rzg0(bJo0+" gNجg4(0O 1[9F`~f=G@M!nS^cpY36 4I`xMOٍ9>GC؅/MMCs=#AFhCj{%0%&@aC=]g^O@xFYhA@ lj7zfN۽Y)# yB2|f=#()Cۭ=3uJO<Qnҍ>_gpEBF|cיS44F`pzn<#,`3xV8j[~''z朻s=ECAcȳҕ={f=CG v=]'oS44F`pIE`f=G((]Cyǎ'LM\Jr3xV8i]`I/f=B;H1!*%`3H^h@1JOW|]TX3@Zh@A&\5tY7VLMB /QE`if=C6 kۖc[A>&'`3HZh@!Իܶ#B.  Z%PF;d[x OU .E (!/Km ^RzJĄ6HaߥV e (=#C{Jbx+JO>|uMF/T@)Z$p&7rm[9=#@`~_H(K0 54Id6l?x3RsWzN ()RR[y3^YOSv7!?JrcG(=F()M蚰k?&, m8U ۾ z5JϩQJ O}N, m( >[r@Th@1Ԅ;e (=2CC |]v@Zh@1B k; (=2CCJ/= m(&>۰Z6/]Xfh@ .Ag鱫zJ6Hͭd"xb!ퟋ$H M('p\@@)Z"p@VA"<]ožHXA@9=4@@F_:Ԑh[نx-=b   lbZo"vus='hJ@*W"`S"6ATmNgo$xuS952|@.X-="HlhMjZW?C m*Pz &$Wv䎞V/L@lC"HrhMoAEJωNWۚ|_[c +PzN &PD`oAEv3(!pqAJkqD&2W hCܧԔjѡ '\.i\Y N)=ޕPWsrvh }hn("PsBj*zǺRGo szth 7_E*09!5|ilVYzNO-8I .Ej09)6|`aumf=x a_6@}f=/ "p.nRmŮM]ƴ mrJF8I`&mU&oVzN_&BM ɝCNkNu޾-\ڼ䭾JI^(oSFoŮ>+Pz^F4ފ]iVmm/H&Wv>kPz^EDCcuJω^$ OscU@yQnnk& NEmkOJj/8YjsWǽ郧I%pf=/ !pI]=79=A@bG=M*k0yFj(R4i͹f='G0yfr8RIOձzN_'<\xSV[yNHy:uޛ#MM^[ zT.`q' la}bė <[om#z0yvt >x(='x@K^@yAv Dcz^ I%}pG%;^.;(=/$ .obwx%vPz>J.\,A&K1v}mMz.9]Sw yC%YϳÇ Pi,APz^!FE^-u GE)K)淓~<<3;|IJI9%b2Wgx@ڬLz/ k^$oJϋ×P3O&x3=a/c5}H&=rwf=/_$]!@ #-ۤ.f=EE#~ ߤ%#y |/LC C {z.!F ]EH`<6I%P2ȑ!@l.];(=g S X==R\p3z,f&="q*؇?T}f=g WG/D=Cۚ^Ji#)wM*C m]]HzH .&v!@@FHa`#v <"`(9 mie#x (=K ޵lLz.zMt>f!@gi1ѝKqdY@^fv^'x (=J66;<*`3s~3H]Kg)Ї/g )C#vPzazې6~ ^.z&NNf1l_ReGMIk jK'L)!6jKgJN&$po' %SY@I]GY“PFZPzFY&tiqRKf=5Ǥ! z/gx&tE=r/zD(mr-?ov^#v JG()5_ŎS2vE /jJWJ$PR`>ڳW'mZx#, ,2xBHJOP@J$PTտ U/pkX%kPTmN Z);V߇J~-T:^TcJ_9 @hh^Mjbڮ  `SoXyIMamRGLmU,Sg6JIf=;VoOu>Dz`hb1\T(H@);ڨW`.҄' (=H} Ot>HS"~Q>C[d M N@)AR P$%LʼrisgƎPzejyGxSc\s9yJORrg (=5ƥ>q_+=CHS lzD) (=.PsC m(\o/`Sc\s9o~~zep;.0*/u@947tAS2U@agj!J%JOUa>JO,RUݧ;V Q/PzK-'ЅM۴%;p+EZJ`we/0*/u󒸗dJO,TE.O{V^'F H@(-u@^ :_"@@)FH 5X&B L@(-um/K"^O0\-K^(`SKTgYBz c(=eIk6&@ T@%*@no{il iԻ&@ T@&*u@= T:ZTbW (=EHcqׇ],<xҳâ}hS~Wϛ:$@@)K[@B Nx rgYc7 AT6I)w]f=esIk>&; &`ֳâ7!pqڰm (=EcIcإݶ{{ɡNPzzXR`'=Z9)v|S2U>o%' (=5>ȏ' :_&@@)J@  R me=S04U@zN0!.@VƎPzʅjhc(XR *='pd&ivU=f=5>H285u|YOLTC'zK,'ɱJOLR? (=UĥNX:|zE-sv N0Yv^]iĝ: `S:X<幋ჷM ,6)uzէ'-W`wZK&f= K=+*'+K Ď&(=EIc %Nh(!,<+u@DhS44X[Zh(!,6+u@܄YZ]"uA bCMf PBgYceuJ :m '-V 61,(=J++pmA bPzUVݴ!EHhneIkY!2("`ֳجԱ 9 `S6X.4 @YbRNJ lrk : '-V`۴W{C$PF@YlVXYPfizƓ+V#1 0YlVXa[=bG; kwz&RJRR `R'-V 5^ 0 0YlVXQ͕[=bGC 4f_ :  '-ViIҳجԱz 掦Pz'1CJR lþ ]VOlNim}[OHKF.8'u`hS04HڶYMZ((,2-u@lV0u4EnE#Jc 1M]=Ғ@I入q[=%cG[1 }:^$PP@Y\VPYm^Zt"@@)S[l J (=KKJ)+܄cN[S6@.0둼HbAMKQ.I鑑Pz/Gbv[ Pz/&vOAJ%hiR !Ɯ6 Mx\ Oz d$az$/p0NPz/ǗiaK1]SabGKAKq}w9Ș(V]?x4u$H^?m*KGdI` KnŎf (=cUqPz/C:^@Hn#KQ>li@J%h[ (=mG˵ (=WמO`0Gxҷ: ^@XV}<N@XpKq ܪG (=c{(.vL@WG (=:&}=rގ- '`#y <&pw1ܨ2KQՇ (=c;k-Pz/G,pPz/V6.vL@t$0#x <&iQi (=cߪPz/,p0v4M@x'N@XY[=\h=. 캰 H^mjC84J%o6x;p$0#x <:־CƎ (=ғB}#!K{6[=!xg6G^ `mp$0#x <mXϐm둻 y<# *`#y <H1iQq (=ob>T@ئ>ou'P#x <\[[]}2X@ +.^ Ц}` (=ҳ z:Gx(J2 0#x <}tiG^ 6c=J%P 4vq} (= n+*OEA@\p;=Q#x <H :u~GW W^7B8DJ%@:$OV:?#x cQGPz/ެgqKࡀ}tjND}I@a#x <\f# .^lf0x8G^zE (=3x8G^`c 7H`xGx\3|8Gx `PH`xGx qQPz/6> ^ :B8DJ%@kSJ%@z?°s (=[?#x |/(=cc.^f=.^v3sAPz/v/x|GPzOG\@΄#QPz/g(Pz/3(=sqȺK{A #^ xg8( (=Sy J%/^gw? :" K;3(=sqȺK@; J%!znGPzNA?#x (=g[@SP ^J!Pz/3(=sqȺK@; J%!znGPzNA?#x (=g[@SP ^J!Pz/bWuޏ%!8!P@{}0sU v]/UǁK6۰HܮVgsXkT p6Eulw>Clpqڐ~;|x)MH@ _iKivLD`lg,@g<ЎWMVwow U U=J!@ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @&- μIENDB`UIDd>f  C 4Aiw_pont_color"@@RH(ldP+5ʞ~wH=YM FoH(ldP+5ʞ~JFIF,, oExifMM*bj(1r2i,,Adobe Photoshop CS Macintosh2005:09:15 06:36:54z &(.9HHJFIFHH Adobe_CMAdobed            }" ?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?TI%)$IJI$RI$I%)$IJI$RI$I%)$IOTI%)$IJI$RI$LH` I))t1Bƅ;i?gbz~d]?q\Y\E<ޣs)fOϤgufeKP'Q|:-0h^t 'x8|`EkLunOPEۿFN6}!/M/}?IDHk|W~^37)zxgwI%aRI$TI%)$IJI$RIfu1=kIu|papmM I@JF zXh~dW[u{?2~wGE]s7R.,+Ya=QC/e31Fc6Y73􊺧1H-ޛf>\ βfI$RI$7W&pK~g mS9,?Gq$ViI$JTI%)$IJI$SSu<^fnQ4}'8 cu.ltf豃S_MZ[HK ŕOXJlF\ܘvAä?ԒI(]%$I)I$JRߩ_W/M/}O|W?ܰkĒI[y$I)TI%)$IJX[gGyrA}KF뾚^oqf znwi:9q"O?(@4@$RI$I$$I)K~g m^d7W&p?-_rdwI%m攒I$TI%)$IL^{ִ8jWݐ˳;c_Y>X9xIʢ4W:}]eQ/jI$wmI$JRI$I$/M/}yߩ_T|sI$RI$TI%)$INׇY˓i^_߼/i{cvXZ#O?WcC J>)W qKx?GƽZ}xKիcA_LJ?^_߼%_r_cA_{W~%?׫W z~~x+1ܗWc/>5^_߼/e o% com.apple.print.PageFormat.PMHorizontalRes com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMHorizontalRes 72 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-08-26T19:17:32Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMOrientation com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMOrientation 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-08-26T19:17:32Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMScaling com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMScaling 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-08-26T19:17:32Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMVerticalRes com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMVerticalRes 72 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-08-26T19:17:32Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMVerticalScaling com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMVerticalScaling 1 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-08-26T19:17:32Z com.apple.print.ticket.stateFlag 0 com.apple.print.subTicket.paper_info_ticket com.apple.print.PageFormat.PMAdjustedPageRect com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMAdjustedPageRect 0.0 0.0 783 559 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-09-15T04:36:35Z com.apple.print.ticket.stateFlag 0 com.apple.print.PageFormat.PMAdjustedPaperRect com.apple.print.ticket.creator com.apple.printingmanager com.apple.print.ticket.itemArray com.apple.print.PageFormat.PMAdjustedPaperRect -18 -18 824 577 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-09-15T04:36:35Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.PMPaperName com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMPaperName iso-a4 com.apple.print.ticket.client com.apple.print.pm.PostScript com.apple.print.ticket.modDate 2003-07-01T17:49:36Z com.apple.print.ticket.stateFlag 1 com.apple.print.PaperInfo.PMUnadjustedPageRect com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMUnadjustedPageRect 0.0 0.0 783 559 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-08-26T19:17:32Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.PMUnadjustedPaperRect com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.PMUnadjustedPaperRect -18 -18 824 577 com.apple.print.ticket.client com.apple.printingmanager com.apple.print.ticket.modDate 2005-08-26T19:17:32Z com.apple.print.ticket.stateFlag 0 com.apple.print.PaperInfo.ppd.PMPaperName com.apple.print.ticket.creator com.apple.print.pm.PostScript com.apple.print.ticket.itemArray com.apple.print.PaperInfo.ppd.PMPaperName A4 com.apple.print.ticket.client com.apple.print.pm.PostScript com.apple.print.ticket.modDate 2003-07-01T17:49:36Z com.apple.print.ticket.stateFlag 1 com.apple.print.ticket.APIVersion 00.20 com.apple.print.ticket.privateLock com.apple.print.ticket.type com.apple.print.PaperInfoTicket com.apple.print.ticket.APIVersion 00.20 com.apple.print.ticket.privateLock com.apple.print.ticket.type com.apple.print.PageFormatTicket 8BIMxHH/8Ag{HH(dh 8BIM,,8BIM&?8BIM x8BIM8BIM 8BIM 8BIM' 8BIMH/fflff/ff2Z5-8BIMp8BIM@@8BIM8BIMO z iw_pont_colorz nullboundsObjcRct1Top longLeftlongBtomlong RghtlongzslicesVlLsObjcslicesliceIDlonggroupIDlongoriginenum ESliceOrigin autoGeneratedTypeenum ESliceTypeImg boundsObjcRct1Top longLeftlongBtomlong RghtlongzurlTEXTnullTEXTMsgeTEXTaltTagTEXTcellTextIsHTMLboolcellTextTEXT horzAlignenumESliceHorzAligndefault vertAlignenumESliceVertAligndefault bgColorTypeenumESliceBGColorTypeNone topOutsetlong leftOutsetlong bottomOutsetlong rightOutsetlong8BIM( ?8BIM 8BIM U}`9JFIFHH Adobe_CMAdobed            }" ?   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw5!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?TI%)$IJI$RI$I%)$IJI$RI$I%)$IOTI%)$IJI$RI$LH` I))t1Bƅ;i?gbz~d]?q\Y\E<ޣs)fOϤgufeKP'Q|:-0h^t 'x8|`EkLunOPEۿFN6}!/M/}?IDHk|W~^37)zxgwI%aRI$TI%)$IJI$RIfu1=kIu|papmM I@JF zXh~dW[u{?2~wGE]s7R.,+Ya=QC/e31Fc6Y73􊺧1H-ޛf>\ βfI$RI$7W&pK~g mS9,?Gq$ViI$JTI%)$IJI$SSu<^fnQ4}'8 cu.ltf豃S_MZ[HK ŕOXJlF\ܘvAä?ԒI(]%$I)I$JRߩ_W/M/}O|W?ܰkĒI[y$I)TI%)$IJX[gGyrA}KF뾚^oqf znwi:9q"O?(@4@$RI$I$$I)K~g m^d7W&p?-_rdwI%m攒I$TI%)$IL^{ִ8jWݐ˳;c_Y>X9xIʢ4W:}]eQ/jI$wmI$JRI$I$/M/}yߩ_T|sI$RI$TI%)$INׇY˓i^_߼/i{cvXZ#O?WcC J>)W qKx?GƽZ}xKիcA_LJ?^_߼%_r_cA_{W~%?׫W z~~x+1ܗWc/>5^_߼/e o% 1 1658 1293 1 300/1 300/1 2 2005-08-26T21:26:06+02:00 2005-09-15T06:36:54+02:00 2005-09-15T06:36:54+02:00 Adobe Photoshop CS Macintosh adobe:docid:photoshop:5813abfe-180a-11da-8e11-fcb32effe0d0 image/jpeg XICC_PROFILE HLinomntrRGB XYZ  1acspMSFTIEC sRGB-HP cprtP3desclwtptbkptrXYZgXYZ,bXYZ@dmndTpdmddvuedLview$lumimeas $tech0 rTRC< gTRC< bTRC< textCopyright (c) 1998 Hewlett-Packard CompanydescsRGB IEC61966-2.1sRGB IEC61966-2.1XYZ QXYZ XYZ o8XYZ bXYZ $descIEC http://www.iec.chIEC http://www.iec.chdesc.IEC 61966-2.1 Default RGB colour space - sRGB.IEC 61966-2.1 Default RGB colour space - sRGBdesc,Reference Viewing Condition in IEC61966-2.1,Reference Viewing Condition in IEC61966-2.1view_. \XYZ L VPWmeassig CRT curv #(-27;@EJOTY^chmrw| %+28>ELRY`gnu| &/8AKT]gqz !-8COZfr~ -;HUcq~ +:IXgw'7HYj{+=Oat 2FZn  % : O d y  ' = T j " 9 Q i  * C \ u & @ Z t .Id %A^z &Ca~1Om&Ed#Cc'Ij4Vx&IlAe@e Ek*Qw;c*R{Gp@j>i  A l !!H!u!!!"'"U"""# #8#f###$$M$|$$% %8%h%%%&'&W&&&''I'z''( (?(q(())8)k))**5*h**++6+i++,,9,n,,- -A-v--..L.../$/Z///050l0011J1112*2c223 3F3334+4e4455M555676r667$7`7788P8899B999:6:t::;-;k;;<' >`>>?!?a??@#@d@@A)AjAAB0BrBBC:C}CDDGDDEEUEEF"FgFFG5G{GHHKHHIIcIIJ7J}JK KSKKL*LrLMMJMMN%NnNOOIOOP'PqPQQPQQR1R|RSS_SSTBTTU(UuUVV\VVWDWWX/X}XYYiYZZVZZ[E[[\5\\]']x]^^l^__a_``W``aOaabIbbcCccd@dde=eef=ffg=ggh?hhiCiijHjjkOkklWlmm`mnnknooxop+ppq:qqrKrss]sttptu(uuv>vvwVwxxnxy*yyzFz{{c{|!||}A}~~b~#G k͂0WGrׇ;iΉ3dʋ0cʍ1fΏ6n֑?zM _ɖ4 uL$h՛BdҞ@iءG&vVǥ8nRĩ7u\ЭD-u`ֲK³8%yhYѹJº;.! zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)KmAdobed@ z     !Ww81"x A2#$QBa%6vXq  !1A"Tu6Qa2sV8 qB#tRӴU7br3CS$4тDd5 ?пѿҿӿԿտֿ׿пѿҿӿԿտֿ׿пѿҿӿԿտֿ׿пѿT5 -;#;* 8-cˑui)~kqsDZe3yˑg)j"jgLO/`MOljL7[-Gt6\ȭJVEZֵSiGS 'Vk;fbnDr[On=ڶrxnܵ櫷8~,aa3(.]m+xWshT29NKVbqe:&#lfګw;c3>ym{wW#-*kIH,ewD]&)l^)iZV޵Q#f.\?4G/yܞCOUDcfj:j™szpuof o_m?iy%S-+~6u^kgֵuW9Šb>}I%_5wמ1wVN 3KIK6iPҖVяZ֕S kRڽ}=muWyo֝3?-OR6CULժqNݖ0Nz8wRDes>ҳm{q;|1`bi}oRJu)J]oY&~iF5|5WUQhlkvZgoZe6,սa3Uwoӹ31;ф_' fn81I+mNH˓_q%]uOJk᧢ɱm1n3rpg1fb#N"~ f߇ѵ?>r11֍ΑҾg/ gq'3M?կhYo-ٌpj:nGn=qƧkdVA/TKv;vJ~uyƓ8ڱ[S"aٝCU>maS_wW3znE3uǻm ˹ucLW[t3,Ų}ն8-mm)m, 8{'Wv+gƪg{|Gr9 K3bŚ1ݷjɢ"jp#fmS33)Hҿ ̜ao*dݛl2edaUG$⶗_NmZ:毤)-Y)> f&38Ys𖃨jUS3|bSM_&E5v*bP~y~,܎v9Y[a=0C5ӯY-ֵifJY1Mu֊w?Q|Kbծ'jg+7.=] vYgp/,{Ǚ>V+wRRX[z]ţ[c)rcziLx?U`8{rUq? uDM~nnUo+nlNq©sd|s[r='w տi\zmqb "zmu֕>k5=Vpd[Uw?&x㽭omW3wë}iwNe)ҕXo_z1Qnq\*m.ΩV8ٍZc8Pwy2enyoiZVM}OIJYâ9ppNwJAJxq>rQ&D[ybΏU8~ܝfgLmp؍xnIoӸf-վ]OrzK}]&f,]Zksfk𙛕\᪩{s2t D2ђвv2Vc݋VtLv@^c}} pĸ궟l5AOK|uI@ӿ>g|Gϭ$~=ұ;FR㎚$_쬶]楧֦ziuOW ƜoN'7߯(ߜ# f|5DE8SSf\9~8./*j|QxizZmLܺXZ,/k'K)KnaeKz7꧱j"BP[/^Ѩl^ͫ3n6Un&6|yGhpqmڶK漑pzXklT1v[JJYZyj;;%5rV?hSkqeXU[*8?\T1"pވs_|?߬r'l.:lt^z&ܲKC=-nG.ҽ EBϪ)c1e+\o9noN=W-zc5Mjbcz˜crߞcqMoNb/l-ef ;;x-䖷xk`ڇ4[%3+3TNb?.{ox# qn6.Qg3UȝUc-\+0FBŬ{|N P}_}g,죿Kҩ5Ւ{iJ}4݂j<ԮNknʮLܜ?$nDOmp8+L>,Vuk'jN\q rs5Llù31W+yvebƝm4\{%)4RpoΔ>Du6UDӘWM38o q;pen3OW~/ .ަ U5Lfn+gdaW5mRuSQF{ WWԵ,+L˯Y.ᄉՋܹrsvSUUmglG!2my{)ݪ)nch"b;Ö4Kg{%Ua7ZGz_;LvFտ?.VV6eeAϑ-A vznY-SֵG򪩦ի5VȦ(;>dp.Nowy{K.ʻ/~<-B$~ԏ+Y\⥷m1]ScIƌn'vhcSs&ݬpf<%NtLQ^f~*MxF4K|Cz$1ρ||ŹyW_2i}`߫&:u+Zގu>qZtUL"';cp'wܮ2ݪ"ijUT\Ng1XLa3>lstY~Y{ogbŋ6};bS]n%/.mZڏu>`Vnρc QGF5]_(e4*u<պWVr< [\)Uٙ\׷|5_rkڜԵ{R5}BzY-B&^S-f7mڳnVtE4DC>npo/}V͆h>i|1ֿYZn,f.>m.,>9) ymw?֏unrM4UUc8S\6>ɸC 7uaCR=őY6O/ѳ+aK$պ?We<6_szcY6a5GsLZZ)̚f2-zVJ3ŻE-W]vU8S3ƾp Tr38j/䌌۸ӿKm;ߓg[ܙGQjvUsf)Gľ\07!nocPӖ77o]wn[8aKN"m4pO%v/? oLr#lڌ΍. >Rq8?m?-|k փƞ׿l,}Vmӭ]u})jt?T43=vOw/GtHo"kw"m2S=CKЫ7譚,s?Vm&' ӜU '~cz)w1b9aSڊ33^1n'+b[h{w36]xD`<nիvúN»pղu-ZA}V-MRx#npcoDEمwgz3DUl鍻=Ù涻w=r7}>;߳ޯSUv1fbš)v\<[zcO,7SjRKe/I9I)/E:EkzS:f8w8Fə)3ӆ/A9ySr6 A+jx\5M5㙽73UM1OѶQҥ@h?7ڗ> KiAkXnx4wT?п>Q|˾ l_Il܈imlY,UZliKB1cD읻V/'.pq6>7x_!T1kLU]5n1mM3~QUt]<{kGlL5؜e&^rp*axePέe~&mƞuԺzCZnfcLLmS[' wg^򓩷#9G೹ .SR~E9 x͛SO]sUvTSvbev o/}V͆h>i|1ӿvOoݳcKkU\x)YroRWiׯJ٬[%3Mt횪؈zpqfkDጕnQM[ʪhǰu||Ulvܜ f iw[fY,;U1-l/lɥdO RH4Kg{%Ua7ZGz_;LvFտmݼvۏEڻoGQ,\,[r+2m,)$)Zץ)^6k3٪fmFٚg;mAָSpRw7~hj\]UUSM131# wM_eGʛr&luf~F:65/Y9b[n'XzӢ%>ldrVWAgeb>UxN3^7%ƿL:+1n۵N64]3nWk V~%۟9#pl&m7L.Щ'[}%)gH$PK=B:k>~؉M?S1֮[rcGcOb"i޿{]nULSLl|Ԥ^c}} pĸ궟l5AOK|uI@ֿ˕YybcctddCikKmzQiz!jb62Muղ)&g"#lˉp' V&Ӳ kƞ۳$vvd<ݏl{Ⱦ]ĜtrWnl?vtշ{vS/Ay|+ \-UpWuNzDʼn-3E3/M;Sr7#]?vMowv42/HC-݇7mc_Xd^]d/AC{WfQOsn1 cpƬ' p{ NBrZ\iQf./onoKFE~ݸgbۡL`o/}V͆h>i|1׿yvZa2"ձn#˩׮6eG5.Ȼ_:\'Cت6b#F8SDm;'ص|}ͮy\d2ݚ5sچj&USr*f*U3F5UoWE5EQTN{/Pҷ>dq|vvLZ-tț-ͩYH5il{b E'鬒\IU6jœ17d;v3NKnFuJ/"_b)C5LWw{vrz3UU1FwUMX9Ö|j_C81.' a}8Rc4п> =lN]|"[WI7%ahz }u խ#eէOkz^TMc1ƪ8SOMSf38$~[r|AwP51ZLnvsMTLMUUU1U15WSÙyκ-S8/<]r&^^^6^ff\dY2&$[ַVkZUU58홝3=zbŜ2j)n1MSM4LaM4E4C󿏨 >Rq8?m?-|k փƞѿjZ`jzn6Kssg +ZYmdZuk麴=5]t[k8Dt̹\k=)U۵LMUOgby}ir9+Qq΍,Y=L1]KoRC|Hod{ #gt힏0zq_'♵ļ鮽#O1E3gfV"ְ^V+(ߜwݙ{+}Ý~Uش1-mI}G]umjYW39FWOf":)""#{\ܹ4̕-X)"kVܘrb!W >Rq8?m?-|k փƞҿ]fZFD8͓4XI<%0%Ydmm+u]^f)D?Vܽr6ibi1jfg;.yylp/k\rŦ%)vU/.Xm5\)mtG%Vk.5`!gNp~0n꣣dݻ0K׸术s.iEq7-dfꯧk55xZ7vy'vkxksfjΛ?;"Yzdl46V;,9y]\5U8#dtD`S+C|'r6٢(pUs5W\UUS2o/}V͆h>i|1ֿ5qMscwi{Ci^n5-ɤ4p z͕4E>4]|Vҷm+jZGHל.ET88cSLm舎6./2)9f(qv馚SE5W;)rwtkėj|as ΂ qK~]})ك%ϋצu;"6cT/Q8t(*6[N5ߣmSzݦǃzͻj`A/OԾqb\N[O _6uq:dh ׿yeg"]KIaSɺ4~k|ulM%)-&PɇqO|1cEڦv&ӏLb' j}]Xbhf4 O"<5وf#z&W]>n}]or͓m1ӤimL+uifR dߓ%+,][i[ bGQ(>(g3&rg\_FH1"fm˘cSETE1UrW ch?7ڗ> KiAkXnx4wT?п?n-uimm:uWJR֧C5LSLc3yumYzfygJgm^;͊cº*<[W8쾱cn2">4E/Z$w5WE|UW'?' )CW 乁ͫu4:/nfsjj1ȷ]ow}ׯouM׻6.n k*GR͖M-,ءRWk1W7.\jf6=8SEp m9:"ݛ6hۄDtUU8]SUuLTh?7ڗ> KiAkXnx4wT?ѿ[۟nW[[64WZ5t7NӴ.ȭdqu_E)^_ bVYQEF5WVȈ̻-GxSzytڵj3]W;E4333|ǘ~ wOWg C&In=YnɧiVILknLVˬCm9{QM*v#S{80݈gU>_Qof{W"ld' l3kLEGs6ٷFUj1ko/}V͆h>i|1ҿ|Wۦfd9l\Fx!}>:L+JY 1ҵK޷euzIjW"~æ{Fٜ"6^r׌ĖxO5s#E5avmۧUU[)ib]rz0|G8^-6JJշN5Տ#+Z*=Mmd8=QU6Vs =#dO"YpgW6֫Ը幦vimMqR*DŽ Ns >Rq8?m?-|k փƞӿwý F,r12brx,czk)&T+nn]N'xk)vqۏ\pG8ND}~7 ٛykXUWLŌLoUzwm3\5LDa4.`+2&jhOZ~Lmw, $&J~ft acW.&o?V-ɢ>vaS; ^8FUo;]1؍1z-Ywh#zn\kj_C81.' a}8Rc4Կ9 =ƽm4۸t2A= J_.ՆKoK./OXFkZwnx󾡅7Ǿ 31:uljXfFU<4ZjtuTa1f'ׇɦvS0Fz.sVds6V8rxSsRbb'UܻUs Yk޻fZγ-WQ׵SQ_3#Pu[7#Q<+6Nn~~]4_Z|][z֪v*zfffgfgl/s2 hS[nhnc ib)9` >Rq8?m?-|k փƞ׿ߚ.x^ڷ6Wݕ]nNiy6ҰgttuȮ^V9a=74m&;V? 7S^)6ZvK's58v;*SUӻ4tU;;7SԵ,̭CQ23%˖YYIeKI/]ukZֵUU5333홙陞L_/e-jժi())ib")"""""0~Wj_C81.' a}8Rc4п+ɏqv6m4y:?'~I#ڑJÛl5vu:ٙekn:oB eD&۴bzh{5OfG61RΥqY^nw+4ic m3vň&թ쪨xEuWI&IeeY.$W%ukZֵk^eSni0؈ >Rq8?m?-|k փƞѿ yDzc]v͸xMNHrR- z]NffYZctP0yhD+1v;b(Sٟ荸zԳe\EVW9f.}s3hhb' jc*<]UIYdYe%KI$I}kZֵkZ׭jfg{5Eۦ("i"#dDGDDv" >Rq8?m?-|k փƞҿ~m~iq_mۚR#Hϴ4˷\TGmV[Ꮽck ssE<,r#F1c%_RN7g94א]܉/ߦv͛sncvUtER$IYdYe%KI$I}kZֵkZ׭j33mQM4"#";~z}3pZ#=/&;#Aӿכ7&۟ jx4n=+۷qf{L^-ѵ8zI/ľYɆoþܜnHbʉyVUU[٪ -S?)Fڶn^(}F0g@ܚ+  Ta[uD˱V+vj egdffM49yyy2VluI%VᄉխkZֵW:3fg/rXF[-E6ۦ)b)i)cb"""""#A/OԾqb\N[O _6uq:dh Կ8mx;UՃ64v/1] ^-Ԓ95 x[]}]09eMӦ*cΘޟюL`MzfǬ;r d ?v&&-SWs4َLaLM;֦~jzާZ֣v^jڦ^Fꚞv^~|<,K}}պֵUU۵MUU3338홙3;fgfO'>,Xvۦ-۷E1MQE1ESM4SM1o/}V͆h>i|1տ^mnFܮxs_|:.?Mwe[|xˢŲf˿v] * d>?VGM]-TΫZX(UpBf]Z*^\ݚbjE6.vߛpj[xnJ}[_iv?JVJR,[0mEGeҮfYbnrUS3ȈDDCa< VO#ٷQDv#333UUU3]uUUUU3>;j_C81.' a}8Rc4ֿvMYsVsz_qɊGtk[_cvDf m#ikd7U.ӧ5{Vv㦪 m13cLX._x[#-{9U34ewb0)j&&эqD~h^@JɺzْYei|2KtN[>&=.⺿/[ꡩy_;sPUr=)Gb?<328 ygy> TEuDEWnׄoݯ ji)~Z3 ^c}} pĸ궟l5AOK|uI@׿NL4\)Ӵ+gCѰ?k4tu[޴ZGAji0ffvmyQʾ+e8+lK~Z]"pbj虘'n5׺HV9IJ{ڛS ZI-#)mr羔-!N^;?+]Md[e+&׬6_gImX;ʾz|[Bjr|7j͍3T]Uh=_8.w(1覬jb&2f&bn둿]uEm󱆭04Kg{%Ua7ZGz_;LvFѿϑ,3d>>Rq8?m?-|k փƞӿfihUyq]4O[ UŤYVW{qmYi>ixmpΙ1g 7?\pgL;mm"KzƃM뻳>h7<%کf-ѽrh6\&r}{_gU͒j:v^vnL%_u^vگުj3382سMr>cISc-EV)n1MS/o/}V͆h>i|1Կ?ql>ظw"I4fد5ZK+|q|d1I,_m<]kJWֵ|]ԳF1Sͳ'*ye㜏pVc9\DTQfN7/W1N7 fb"g P7tɺ'UJү͛7lm*nm n1G$5"TmsYO9=}1M1i>(#i|1տ?~~j0a`A&N^^LÏ<6IoJRk?c]tLTewh.N4ӶTxN?N`mlx+u\-v]:vO7NAZKJIuK%Ǽ[_j>-3K1Dc&z)&gfl?׫^[< Nڢ$^n/jp5U_s;_)N^ .W`o/}V͆h>i|1ֿ+_svkziXMUɦhpRlml}i.ɨY}:blٕ<nw_z)TOݘ*zzeG9kY/YuWaHmIrae6xcJ;6jLFzf{8DΪ^<ķދlb")FTM>Ȣ"S4x:kn{ZQsoT˭d:vn~l$}im)JuJRMzbW5W\UL3?["zfCDr>j\,ڷOɢݺb(q)"#ٶqxwz}3pZ#=/&;#Aп7ۜo7F::6ٺ7}Ãi8fO}]m,NRJVLjG)s7)3US=súzOt+Uf3YN8rqM3g@{ݝsf}GhMqͻvɺ 3r9/R/m$PZT~*,LŸƛTOюb6oOMSnf"0uu~^[e8C!ME7u jiviŠbܯtӸA/OԾqb\N[O _6uq:dh ѿw;ҸYٛ;7TMcK͛pn-PҶ/f4R܉ɿ;lˣȅ_9ő~ޘǺ0zv1PW h/U5[ӭ\^wmjF6艛ߚ۸zA/OԾqb\N[O _6uq:dh ҿ柙{=vu?wMIf-3Wy[$zn۲$k[}0~;zxkGT~{g> cc@ηcSWPTU1?\M1stF6srif:k~jjz6nݓuM4]t%պ[kZT˓5UT33ffzfg[2\VG#n6lMv(((ib)~\z}3pZ#=/&;#Aӿ=Kz ǻKroݪbcjhچ8:f~VVDYvmI,qsYK/^k3TSEfvDDmD;~uN(2=Y1ݢ͛tEUU]˕E4U331fg"T 炙mOp5I }4m۱m) weS+2ݙ}ՒJ_%!UG!ĺs1j;TWʫq1lϒ:?!e4W"1N7uo5LσZF3\[ >Rq8?m?-|k փƞԿ+͇ٿj[~[I0o|ۛ٭}mڅW>C< d«~ZmګclL~9zUn|1v4uowo&ݢ< T]7+ESYh?7ڗ> KiAkXnx4wT?տu'us7o,jCnr|uH/yx vNm5AV+5Z\6"j~LF;pN"{ ϫ%n{s?#Ymq۵Mn3DaWEU[SF38۳pѯ=٩Ϭ]ϫgkzީH3Q'FL m;~Z\5Zq>u6ޑ]QRK2%W_|Xedj _f^rih *Lb{I9G%]kV,EMLf7Yƪfjb".Qj%ʆ >Rq8?m?-|k փƞ׿r_]ƛ'W9SVVFvEw&6f #9ǺvKdG-"+dƼi4ej1ƘhV1NDLD+;TgżCb.=US]6ffg-bijަn\UQn&+1J6j_C81.' a}8Rc4пM延{{OE;KEԷbazV-yeVxm$N|jO/^o1;5U3""1öt=Shjg3hfUuܹTSDE4D8&pşWy;<˭htK*eiSAf-Ѥ-Id nLԷ"iidGK:S&owS*h0ݢٝg ܃WU4\Ȫjٻ~ibb-۟DͫtcDU,A/OԾqb\N[O _6uq:dh ѿ?x=591񋇻9O+l\-ۢm.GuEK?˾g[[nlq$pR+]ٌbb=|=LaT=R7oZֳ<+1^_NMqnjLDGwUQVZi߷LxKܵ\jp{< >Rq8?m?-|k փƞҿ>G\dz7.oKMۻ#ohbQƺM{yR|h,omkҽn崍: -S3?SDtf=kpG ڪkQEpMSan8]sLLc,9g==mrc n>c{;l,pbEu:]}n]Zsj9_Pf#0v輵7xzܦb4c5cU˕c3WnU]ʢ'v&b)c̀j_C81.' a}8Rc4ӿ*]ri{zMٶ_V[rvk}%%mvZV@|9~WхwmN؎bqg?#c!f9|/ffM6iƜfO嫳MT~V =_z}3pZ#=/&;#AԿw9[[n >jtvf&N&$~[]̾DŽjeeI }޺R:}sUzUO1mSGT즘Sm9Cmc7b*n4]c;SUS1;0g[~Iޙj{{n Oqyw˕-nȻK%[[`ņ.Pdvm;fgs3rSUSg1## 8St~ ᬏ OOnŪb)ݷLSV458r7몪1z[^c}} pĸ궟l5AOK|uI@տ ywe]{[-.8>b/+{jUв|>ZI+.*+}\A/Wsg Tw44j?O>s[gU7m9KuGN8S0)r'n+ޤ4Kg{%Ua7ZGz_;LvFֿ7d٧lYW"쌼;iZ뚦_Dүjyj>ivcTI˝_<ҸEh*j0)ո"wigw9 xjꛧz[skSYͿ;.Y}nGmأzYe-ޖJ)o5=˵MUO5N3F7W K4;Qg'ٷDa۵DQN8DcTcUXcUS5Nٗj_C81.' a}8Rc4׿~=[nچռzvҶ=5˲u9eKIIJ%k+^|A ];Tg Gu4F/e NKզ躇:5]ciD/ڌ<%[jQUޢg!w 4Kg{%Ua7ZGz_;LvFп_4r*-_XSǑf~LxXuo{lQOMnjYV{QNYj:gv1?. 3Uiӽc8SO)ꞈƩC;[<9Wz͝w$YǮdf.F$ Elue*TQ_u ]ڦ3=˜˜""LGh:wplQbE4ѽʩh߻\vLDܮۆ@h?7ڗ> KiAkXnx4wT?ѿsi;gQ۹/u݋| 7t^ml+.)Kmϊl/.x$.okͮ;nO NDTa;7v׬?g(#9-NN*dfbp)W)m٪SښgL^5DU^c}} pĸ궟l5AOK|uI@ҿ=rn'iwtkphwHu[.y`ӴK|#[W,[ԧvZynDoO43;}Mnf3Whn\QLDQW88aM3T"YweZs]5jH˗@Òɡ^ө4adV[s\sڧv> #e13sޜ[FS.QrF FC/L^&'fn~3^QFUz&iqE3ЎΙ)A/OԾqb\N[O _6uq:dh ӿ8xw~ Ǹ 쭹4qOm{&YHr$dfKSY"ղsK\cNVs}GD؞fzwr8qΧjkp߉Ɗ7ӽU5ݯ1S]3kz"fKj_C81.' a}8Rc4Կ(ܕSizVV⼋fA$6EW2Y"k xU?Z\KzhYQkc<\--SFjb(1LN^DcTZ=UVʮDai0z}3pZ#=/&;#Aտ3)\}v;;FeHMɺMứ]#KɦK2#ĥfE]좾uxYv' LDlu4ӻ?L7UUwh-zLMtav;STUmQUSLoMS ]uuuun[뮺ֵֵT.٦")#@^c}} pĸ궟l5AOK|uI@ֿ y]|wvR]#ofN5uV zCmr`r]ۣ͎G/{Y6#WL|14튢p{]fru^k+UQruUuw11U4Yzb+ԇ4Kg{%Ua7ZGz_;LvF׿Էxgn} M'nmTZޣ.&]$97[miO}5)Nef*ݢ3T":e>WyYfqM1L:zsqI~;W4;";LȬZ~VRq8?m?-|k փƞпx>+ƺ>>z=0l\flzȟK/|Y6=>1枱ÿۜ.|;nO_ܰݹQ^K;UU3k)LUS\3Vgz^+3pz}3pZ#=/&;#Aѿ^u}M̝'O+xI*sCOrgz8JI |raV۽iX쫼'SZUx8*b o8 ~ [q%ڳ&hck+nvQޢicхSdt`4Kg{%Ua7ZGz_;LvFҿ;1<}lmǺ,lt6L,c)Y'e.JW:[PK/7cl]sNd3N[n{|}>C,eff"]4]XDMUULK9]չu94fn]s2أzƻIjy4R)$wRҔ1~jyӍw*fg-m'#hM KVmXN3;Mt;g )v^v@4Kg{%Ua7ZGz_;LvFӿ࿟;Y;kٜ!f{_'o[̒e=VM"{JKmKlIͽZ2%*^jxU=tzEir!y&r?mUvjs3ɚfjb* ^c}} pĸ궟l5AOK|uI@Կל<~gW+k𦗧qfl`IiջUYEE55,p'RVyyE4N6 ٽk˽3L `|jY{ ^w7kUo+LnNXFgu@j_C81.' a}8Rc4տ>Uͼro,k4o}˻Ǯ\[rgYX:}Jz}5=4<7N\v?s?<3^sHଆTջSD=DOGD3[XޛqÓLvk3)pS/Xu 5MO&JYg[JRzR1~jyӍw*fg̶Ѵ4.YN3;Mt8E18c/; h?7ڗ> KiAkXnx4wT?ֿ81l/ȥ6#G q2cڛ:no2֕*æbIdl=n[b,ƧN!LYSGw3ivwOB? {/۱3DUL3Qw;y1ck2z}3pZ#=/&;#A׿)7rwj0fh|4x-ݼsn8ηҸmץeo͍O#3NVS]}[{;7?&ߍWU[qnؙf*ef0;fv#0o/}V͆h>i|1пj8>j{+ /Q͖.=9Rz}[Z]6蛕tDc?eovYh޹zh>3R99S,}Mɏv%c9hztKm¦>-RJRWתjF*1鈙,7+_h)2v,UbQn<5q3?rqe'\^c}} pĸ궟l5AOK|uI@ѿvy;ؗVMao:wK 0ݷ;pf~<}coOrW?wqr%D)b.]ݽ3TLcV(Xmz}3pZ#=/&;#Aҿ -R- Ûu]{ 2\_Xq]Y0߮+KXY_E?EDvdnQޯPb)<bf樹T3W1Gw1;7z6ҫ{ o/}V͆h>i|1ӿ )rUϖnF[d{&li)5)J] KiAkXnx4wT?ԿwN6[Y<]kZղe"t]>MO>yfeE]uR=5yk.[jS J뚾WES5^b1vmUDFۨoWޯd1un۩Ǎo=Crjk9AgYI&)Iy󙫹*]U3T,+<=ἔVtqhjTMSٙ~j_C81.' a}8Rc4տl|wvϚC&~p)"jqmZH_$ifdVu~IW0srp1j"vl5OZ<iS&bBzsabb "w58 >Rq8?m?-|k փƞֿAqnG5[uT-bm -K|RmzW2BZtcur%;~9cZUyܙQڸ:Vnqٓ_\, wQ}[m=nSŲ{־8ekRqUYzgۢ;T\9޳M{5u٢hɢ:"g|hyط_i_ NOV4xZ_ӺTп;9/+2s1ҲmزmWAmxMŲ+m+})U4lZs8w݊;TCiNA *V[MjT_jٍpr8Sѥv-WWӽ=r8SՍ;k.c?6U;2ѿq\ܝE8{nzCudi{#/ ctexӣֳNgP1VU1L|-{p*Ե _z&覺'd44C8JַV]Zֵk^kkZ[k8be}m-;#=Xӿj3oNۯSC ҿ凜!dl9r,R+Rz+w<K[_24MBmұx[Oܻ^rr#j6ǽ\MQ銱_ n:y1z֛o5&1&^l\&LWwGʦ ؤv-WWӽ=r8SՍ;k.c?6U;2ӿ_o<.+ߋtj;},ʺؠ{vdޗVi5ް[RRZ 7d2yvܹUΞޏ#o8ӊxb"S%;fՎr}DN;a4<[쯴zzpw<]-]zmWuwdԿoc/wxvG `j_mھݚuY캞ve)_ut w5?ѵf*]uc=i=1w-ֱđj,Z[+zqDI@be}m-;#=Xӿj3oNۯSC տ^'2,bhzؽkwKce/Ξ rikK|wTay Q8QG[&:V],3Uo1zSzmUoFcl-kbe}m-;#=Xӿj3oNۯSC ֿ?n-uimm:uWJR֧C5LSLc3 ;X܉<ٿ'+*l{3Xś"kG}ҾkZt3]rWT[[AܶDQsNr9jfi[V*b&:b'cNCžJ[wG z c׬gޝ_J~@׿>Sc7uY8~nܚ,{{}ZCᎶ[[uikҎTӓs9,ڮ53^7>MG?STc1nؙc{b0阆mPhyط_i_ NOV4xZ_ӺTп 7a/ZQvdt{^Dp ҵo?utVf)9Vf(]P4 d(FjvDFFgNىڠ6^v-WWӽ=r8SՍ;k.c?6U;2ѿ8矼1a-nsmM֒`j2/+,Hk[.m_s[38J}mQڙbWndڍ'Kٚv'e)cn9c"c &jS `@be}m-;#=Xӿj3oNۯSC ҿ+C͑n~ZǶH&&yKd5)u)K_enC|QNvkUQ(iP &cq>ilUVfsTܢ"pf2TL4MXLSe|{\4<[쯴zzpw<]-]zmWuwdӿ*Ez62`^mzl+dra_4-> V-tl `_5CvwlJ]8ѴY!n;lJ+Qnlԣ'VG Y*jFljNGs1^4Nigg1i}O\cNNjX;nN ?׿3Wޯuڅ}JwV_K/HޙF